KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-188: F542_13360Help
Entry
F542_13360        CDS       T03017                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btre  Bibersteinia trehalosi USDA-ARS-USMARC-188
Pathway
btre00071  Fatty acid degradation
btre00072  Synthesis and degradation of ketone bodies
btre00280  Valine, leucine and isoleucine degradation
btre00310  Lysine degradation
btre00362  Benzoate degradation
btre00380  Tryptophan metabolism
btre00620  Pyruvate metabolism
btre00630  Glyoxylate and dicarboxylate metabolism
btre00640  Propanoate metabolism
btre00650  Butanoate metabolism
btre00900  Terpenoid backbone biosynthesis
btre01100  Metabolic pathways
btre01110  Biosynthesis of secondary metabolites
btre01120  Microbial metabolism in diverse environments
btre01130  Biosynthesis of antibiotics
btre01200  Carbon metabolism
btre01212  Fatty acid metabolism
btre02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btre00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F542_13360
   00630 Glyoxylate and dicarboxylate metabolism
    F542_13360
   00640 Propanoate metabolism
    F542_13360
   00650 Butanoate metabolism
    F542_13360
  Lipid metabolism
   00071 Fatty acid degradation
    F542_13360
   00072 Synthesis and degradation of ketone bodies
    F542_13360
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F542_13360
   00310 Lysine degradation
    F542_13360
   00380 Tryptophan metabolism
    F542_13360
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F542_13360
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F542_13360
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F542_13360
Enzymes [BR:btre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F542_13360
Exosome [BR:btre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F542_13360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD Ketoacyl-synt_C ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AHG82054
Position
complement(1438308..1439489)
Genome map
AA seq 393 aa AA seqDB search
MKNIVIASAVRTAIGSFGGSLAGVSAVELGTTVIKSAIERAGLDMTKVDEVIMGNVLQAG
LGQNPARQALLRAGIAQEVPAYTVNKVCGSGLKAVALAAQAIKAGDANIIIAGGMENMSQ
APYLLDSKSRWGYRLGDGKVQDVILSDGLMCAENHYHMGITAENVAKKYGITRQMQDELA
LSSQQKATAAIQSGAFKNEIIPMNVKIKRKEVVFDTDEFVKQDSTLEGLSSLRTAFDKEG
TVTAGNASGINDGAAALVVVEEETAKALGLNILARIKGYASGGVAPDIMGMGPVPATQNA
LKKAGLTLNDIDLIEANEAFAAQFLAVGKELGFNPEKVNVNGGAVALGHPIGASGARILV
TLLHAMHARDKQFGLATLCIGGGQGIAMIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagttattgcaagtgcggtgcgcaccgcaatcggcagtttcggtggttct
ttagcaggggtttcggcagtggaactcggcacaacagtaatcaaatctgcgattgagaga
gccggtttagacatgactaaagtagatgaagtgattatggggaatgtgcttcaggccgga
cttgggcaaaaccctgcccgccaagcgttattacgcgcaggtattgcccaagaagtcccc
gcttatacagtaaacaaagtatgtggttcaggtttaaaggctgtggcacttgctgctcaa
gcaattaaagccggtgatgcaaatatcatcatcgctggcggtatggaaaatatgagccaa
gcaccgtacttgttagattctaagtcacgctggggctatcgtttaggcgatggcaaagta
caagatgtgattttatccgatggcttaatgtgtgcagaaaatcactaccatatggggatt
acggcagaaaatgttgccaaaaaatatggtattacccgccaaatgcaggatgaattggca
ctttcctctcagcaaaaagccactgctgccattcaatcaggtgcattcaaaaatgaaatc
ataccaatgaatgtaaaaattaaacgcaaggaagtggtttttgataccgatgagtttgta
aaacaagattcaactcttgaaggtttatcttcacttcgtactgcgtttgataaagaagga
acagttaccgcagggaatgcttcaggtattaacgatggcgctgctgcattagtggtggtc
gaagaagaaacagcaaaagcattgggattaaacattcttgcgcgtattaaaggctatgca
agtggtggggttgcgccagatattatgggcatggggcctgttcctgcaacacaaaatgcg
ctgaaaaaagcaggcttaaccttaaacgacattgatctcattgaagctaatgaagcattt
gcggcacagttcttagcggtgggtaaagagttaggttttaaccctgaaaaagtcaatgta
aacggtggtgcagtagctctaggtcaccctatcggtgcaagtggtgcgcgcatcttagtc
actttattacacgcaatgcatgcccgtgataaacaattcggtttagcaacgctttgtatc
ggtggtggacaaggcattgccatgatcgttgaacgtatttaa

DBGET integrated database retrieval system