KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-188: F542_16660Help
Entry
F542_16660        CDS       T03017                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
btre  Bibersteinia trehalosi USDA-ARS-USMARC-188
Pathway
btre00450  Selenocompound metabolism
btre00970  Aminoacyl-tRNA biosynthesis
btre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    F542_16660
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F542_16660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btre01007]
    F542_16660
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btre03016]
    F542_16660
Enzymes [BR:btre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     F542_16660
Amino acid related enzymes [BR:btre01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   F542_16660
Transfer RNA biogenesis [BR:btre03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F542_16660
 Prokaryotic type
   Other AARSs
    F542_16660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 UME
Motif
Other DBs
NCBI-ProteinID: AHG82381
UniProt: A0A4V7IBM2
Position
1821067..1823142
Genome map
AA seq 691 aa AA seqDB search
MSNRKILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNQVHFVCADDAHGTPIMLN
ADKQGITPEQLIEKAKADHVADFAGFNISFDNYHSTHSEENKAITRHIYNTLKTNGFIKS
KVISQLFDPEKQMFLPDRFVKGTCPKCKAEDQYGDNCEVCAATYSPTELINPKSAISGAT
PEMKDSEHFFFDLPAFEAMLKGWTKSGSLQPEIANKMQEWFEGGLQQWDISRDAPYFGFE
IPDAPNKFFYVWLDAPIGYMASFKNLCDRTGLNFDEFWQKDSGTELYHFIGKDIVYFHSL
FWPAMLEGAGYRKPTNVFAHGYVTVDGQKMSKSRGTFIQASTYLKHLDPECLRYYYAAKL
NDRIEDLDFSLDDFVQRVNSDIVNKLVNLASRTAGFISKRFEGKLAAELEDPALFGEFVA
QSEQIAASFEKREFNKAIREIMALCDKANKYIDDKAPWVIAKEEGKEAELQAVCSMGLEL
FRVLMSYLKPVLPKLAERAEAFLQTELRWDNIDTPLFNHSIAPFKSLFTRLDKKQIDAVI
DETKALFAESVQAEQNKQKSAKKEEKMTASENQTERQIEPIAPEITIDDFIKLDLRAAKV
IHCEAVPKSDKMLRFELDLGDHKRQVFSGIKAAYPNPEALIGRFVVVIANLAPRKMSFGI
SEGMILSAGTGGSDLFLLDADSGVTAGMQVK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccgtaaaattcttgttacttgtgccttgccttatgcgaatggcgcaattcac
ttagggcatatgcttgaacatatccaagcggatatttgggtgcgttttcaacgtatgcga
ggcaaccaagtgcatttcgtttgtgcagatgatgcacacggcacgccaattatgctcaat
gccgataaacaaggcattacccctgaacaactgattgaaaaggcaaaagccgatcacgtt
gccgattttgctggctttaatatcagctttgataactatcattctacccacagtgaagaa
aataaagcgatcactcgccatatctataacaccttaaaaaccaacggttttattaaaagc
aaagtcatttctcagctgtttgaccctgaaaaacagatgttcttgccagatcgttttgtg
aaaggcacttgcccgaaatgtaaagcagaagatcaatatggtgataactgcgaagtgtgt
gctgcaacgtatagcccaacagagttaatcaatccaaaatcggctatttcaggtgcaacc
cctgaaatgaaagactcggaacactttttctttgatctgccagcctttgaagctatgctg
aaagggtggacaaaatcgggttcattacaacctgaaattgccaataaaatgcaagagtgg
tttgaaggcgggttacagcagtgggatattagccgtgatgccccttattttggctttgaa
attccagatgcaccaaacaaattcttctatgtatggcttgatgcaccaattggctatatg
gcatcgtttaaaaacttatgcgaccgtactggtttgaattttgacgagttttggcaaaaa
gattcaggcactgaactttaccactttatcggtaaagacatcgtctatttccacagcctt
ttctggcctgcaatgctagaaggcgctggctaccgtaagccgacaaatgtttttgctcac
ggctatgttactgttgatgggcaaaaaatgtctaaatctcgtggcacctttattcaagca
agcacctaccttaaacaccttgatcctgaatgtttacgctactactatgcggcaaaactc
aatgaccgcattgaagatttggatttcagccttgatgatttcgtacaacgtgtaaacagc
gacatcgtgaataaattggttaatctcgcttctcgcaccgcaggttttatcagtaaacgc
tttgaaggcaagcttgccgcagaacttgaagatcccgcattattcggcgaatttgttgca
caatcagagcagatcgcagcgagttttgaaaaacgcgagtttaataaagcgatccgtgaa
attatggctttatgcgataaagcgaataaatatattgacgacaaagccccttgggtaatt
gccaaagaagaaggcaaagaagcggaattacaagcggtttgttcaatgggcttggaatta
ttccgtgtgttaatgagctatctcaaacccgtgttaccaaaattggctgagcgtgccgaa
gcatttttacaaaccgaattgcgttgggataacattgataccccactgtttaaccacagc
attgcaccgtttaaatcactctttactcgtttagacaaaaaacaaattgacgcagtgatt
gacgaaaccaaagcactctttgctgaaagtgtgcaagcggagcaaaataaacaaaaatct
gcaaaaaaagaggaaaaaatgaccgcaagtgaaaaccaaactgaacgccaaattgagcca
atcgccccagaaatcaccattgatgatttcattaaattagatctgcgagcggcaaaagtg
attcactgcgaagctgtgccaaaatcggacaaaatgttgcgttttgaattagatttaggt
gatcacaaacgccaagttttctcaggtatcaaagccgcttatccaaatccagaagcattg
attggacgctttgttgtcgtgattgctaaccttgctccacgcaaaatgtcgtttggcatc
tcagaaggtatgatcttatctgctggcacaggtggttcagatctcttcttgcttgatgct
gacagtggtgtgacagcaggtatgcaggtcaaataa

DBGET integrated database retrieval system