KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_12070Help
Entry
F543_12070        CDS       T03018                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Pathway
btrh00010  Glycolysis / Gluconeogenesis
btrh00020  Citrate cycle (TCA cycle)
btrh00620  Pyruvate metabolism
btrh01100  Metabolic pathways
btrh01110  Biosynthesis of secondary metabolites
btrh01120  Microbial metabolism in diverse environments
btrh01130  Biosynthesis of antibiotics
btrh01200  Carbon metabolism
Module
btrh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F543_12070
   00020 Citrate cycle (TCA cycle)
    F543_12070
   00620 Pyruvate metabolism
    F543_12070
Enzymes [BR:btrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     F543_12070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AHG84071
Position
1212331..1213941
Genome map
AA seq 536 aa AA seqDB search
MLNRVEQELAQLGITNVSEIVYNPSYEQLFEEEMKPELEGFEKGRLTTSGAVAVDTGIFT
GRSPKDKYIVLDDTSRENVWWATDAVKNDNKPMTQETWTHLKGLVTNQLSNKRLFVIDAF
CGANPDSRLAVRIITEVAWQAHFVKNMFIRPSEAELATFKPDFVVMNGSKVTNPNWKEQG
LNSENFIAFNLTEAVQLIGGSWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEDGDVA
IFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFEGGCYAKTINLSAENEPDIYAAI
KRDALLENVVVREDGSVDFADGSKTENTRVSYPIYHIKNIVEPVSKAGHAKKVIFLTADA
FGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTKYAEV
LVKRMEASGAEAYLVNTGWNGSGKRISIKDTRGIIDAILDGSIENAEMKTLPIFNLAVPT
ALPGVDPAILDPRDTYADKAQWQAKAEDLAGRFVKNFTKYTTNDEGKALVVAGPQL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcgtgtagaacaagagcttgctcaattaggtattacaaatgtgtctgaaatt
gtttataacccaagttatgagcaactgtttgaagaggagatgaaaccagagttagaaggc
tttgagaaaggtcgtttaaccacaagtggtgcggttgcagtagatacagggattttcaca
ggtcgttcaccaaaagataaatatattgtgttagacgacactagccgtgaaaacgtatgg
tgggcaacggatgcagtcaaaaatgataataagccaatgacccaagaaacttggactcac
ttaaaaggtttggtaacaaatcaactttctaataaacgtttattcgtcattgatgccttc
tgtggcgcaaacccagatagccgtttggcggtgcgtattattactgaagttgcgtggcaa
gcccacttcgtgaaaaatatgttcatccgtccaagtgaggcagagttagccacatttaaa
ccagactttgttgtcatgaatggttctaaagtgactaaccctaattggaaagagcagggc
ttaaactctgaaaactttattgcatttaacttaactgaagcggttcaattaattggtggt
agctggtacggtggtgagatgaaaaaagggatgttctcaatgatgaactacctattacca
ctgaaaggtattgcatcaatgcactgctctgcaaacgttggtgaagatggtgatgttgca
atattcttcggtttatctggtacaggtaaaacaacactttcaaccgatcctaaacgtaaa
ttaatcggtgatgatgaacacggttgggacgatgatggcgtattcaactttgaaggtggt
tgttatgcgaaaactatcaatttatctgcggaaaatgagccagatatttatgcggcaatt
aaacgcgatgcgttattagaaaatgtagttgtgcgtgaagatggctcagttgattttgca
gatggttcaaaaactgaaaatacccgtgtttcttacccaatttatcatattaaaaacatc
gttgagccagtatcaaaagcagggcatgcgaagaaagtaattttcttaacggcggatgca
tttggcgtattacctccagtatctaaattaaccccagagcaaaccaaatattacttctta
tctggttttacagcaaaattggcaggtacagagcgcggtattactgagccaaccccaaca
ttctctgcgtgttttggtgcggcattcttgtcattacatccaacaaaatatgcagaagta
ttagtaaaacgtatggaagcatcaggtgcggaagcatacttggttaatacgggctggaat
ggttcaggtaaacgtatttcaattaaagacacccgtggtattattgatgcaattttagat
ggttctatcgaaaatgcagagatgaaaacattgccaatctttaatttagcagtgccaaca
gcgttacctggcgttgatcctgctattctagatcctcgtgatacctatgctgataaagca
caatggcaagcaaaagcggaagatctagcgggtcgttttgtgaaaaactttaccaaatac
accaccaatgatgaaggtaaagcattagtagtggcaggcccacagctctaa

DBGET integrated database retrieval system