KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_14900Help
Entry
F543_14900        CDS       T03018                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Brite
KEGG Orthology (KO) [BR:btrh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btrh03016]
    F543_14900
Enzymes [BR:btrh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     F543_14900
Transfer RNA biogenesis [BR:btrh03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    F543_14900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AHG84354
Position
complement(1509243..1509974)
Genome map
AA seq 243 aa AA seqDB search
MITLDILYRDESLIAINKPAGMLVHRSWLDKHETVFAMQTLRDQIGQHVFPIHRLDRPTS
GVLLFALNAEMARQMSEQFEQHQLMKSYLAVVRGYLNGEARIDYPLKVKLDKIADKFSTA
KEAQQAVTDYKHLAGIEMPYPAGKYQTARYSLVQLWPQTGRKHQLRRHMKHLFHPIMGDT
NYGDLHQNRALTENTGCDRLFLHANSLQFTHPDTLQKIMINAPLDHQWQQLFLQFGWNFP
QFF
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgataacattggatattttataccgagatgaaagtctcattgcaatcaacaagccggca
ggtatgttggtgcatcgctcttggctggataaacacgaaacggtatttgcaatgcaaacc
ttgcgtgaccaaattggacaacatgtttttccgattcaccgcctagaccgcccaacctca
ggtgttttgttatttgccttgaatgcggaaatggcacgacaaatgagtgaacagtttgaa
cagcatcaattaatgaaaagttatcttgctgtggtacgaggttatttgaatggagaagct
cgtattgattatccacttaaggtgaaactggataaaattgccgataaattttctacagca
aaagaagcacagcaagcagtcacggactataaacatcttgccggcattgaaatgccatat
ccggcaggtaaatatcaaacggctcgctatagcttggtgcaactttggccgcaaacaggg
cgtaaacaccaacttcgtcggcatatgaaacacttatttcatccgattatgggggatacc
aattacggcgatttgcatcaaaatcgggctttaacagaaaatactggctgtgatagacta
tttctacatgccaatagtttgcagtttacccatccagacactttgcaaaaaatcatgata
aatgctccgcttgatcaccaatggcagcaactttttttgcaatttggctggaactttccg
caatttttttag

DBGET integrated database retrieval system