KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_14990Help
Entry
F543_14990        CDS       T03018                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Pathway
btrh00071  Fatty acid degradation
btrh00072  Synthesis and degradation of ketone bodies
btrh00280  Valine, leucine and isoleucine degradation
btrh00310  Lysine degradation
btrh00362  Benzoate degradation
btrh00380  Tryptophan metabolism
btrh00620  Pyruvate metabolism
btrh00630  Glyoxylate and dicarboxylate metabolism
btrh00640  Propanoate metabolism
btrh00650  Butanoate metabolism
btrh00900  Terpenoid backbone biosynthesis
btrh01100  Metabolic pathways
btrh01110  Biosynthesis of secondary metabolites
btrh01120  Microbial metabolism in diverse environments
btrh01130  Biosynthesis of antibiotics
btrh01200  Carbon metabolism
btrh01212  Fatty acid metabolism
btrh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F543_14990
   00630 Glyoxylate and dicarboxylate metabolism
    F543_14990
   00640 Propanoate metabolism
    F543_14990
   00650 Butanoate metabolism
    F543_14990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    F543_14990
   00072 Synthesis and degradation of ketone bodies
    F543_14990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F543_14990
   00310 Lysine degradation
    F543_14990
   00380 Tryptophan metabolism
    F543_14990
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F543_14990
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F543_14990
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F543_14990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btrh04147]
    F543_14990
Enzymes [BR:btrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F543_14990
Exosome [BR:btrh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F543_14990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C SpoVAD Ketoacyl-synt_C ZoocinA_TRD
Motif
Other DBs
NCBI-ProteinID: AHG84363
Position
complement(1519096..1520277)
Genome map
AA seq 393 aa AA seqDB search
MKNIVIASAVRTAIGSFGGSLAGVSAVELGTTVIKSAIERAGLDMTKVDEVIMGNVLQAG
LGQNPARQALLRAGIAQEVPAYTVNKVCGSGLKAVALAAQAIKAGDANIIIAGGMENMSQ
APYLLDSKSRWGYRLGDGKVQDVILSDGLMCAENHYHMGITAENVAKKYGITRQMQDELA
LSSQQKATAAIQSGAFKNEIIPMNVKIKRKEVVFDTDEFVKQDSTLEGLSSLRTAFDKEG
TVTAGNASGINDGAAALVVVEEETAKALGLNILARIKGYASGGVAPDIMGMGPVPATQNA
LKKAGLTLNDIDLIEANEAFAAQFLAVGKELGFNPEKVNVNGGAVALGHPIGASGARILV
TLLHAMHARDKQFGLATLCIGGGQGIAMIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagttattgcaagtgcggtgcgcaccgcaatcggcagtttcggtggttct
ttagcaggggtttcggcagtggaactcggcacaacagtaatcaaatctgcgattgagaga
gccggtttagacatgactaaagtagatgaagtgattatggggaatgtgcttcaggccgga
cttgggcaaaaccctgcccgccaagcgttattacgcgcaggtattgcccaagaagtcccc
gcttatacagtaaacaaagtatgtggttcaggtttaaaggctgtggcacttgctgctcaa
gcaattaaagccggtgatgcaaatatcatcatcgctggcggtatggaaaatatgagccaa
gcaccgtacttgttagattctaagtcacgctggggctatcgtttaggcgatggcaaagta
caagatgtgattttatccgatggcttaatgtgtgcagaaaatcactaccatatggggatt
acggcagaaaatgttgccaaaaaatatggtattacccgccaaatgcaggatgaattggca
ctttcctctcagcaaaaagccactgctgccattcaatcaggtgcattcaaaaatgaaatc
ataccaatgaatgtaaaaattaaacgcaaggaagtggtttttgataccgatgagtttgta
aaacaagattcaactcttgaaggtttatcttcacttcgtactgcgtttgataaagaagga
acagttaccgcagggaatgcttcaggtattaacgatggcgctgctgcattagtggtggtc
gaagaagaaacagcaaaagcattgggattaaacattcttgcgcgtattaaaggctatgca
agtggtggggttgcgccagatattatgggcatggggcctgttcctgcaacacaaaatgcg
ctgaaaaaagcaggcttaaccttaaacgacattgatctcattgaagctaatgaagcattt
gcggcacagttcttagcggtgggtaaagagttaggttttaaccctgaaaaagtcaatgta
aacggtggtgcagtagctctaggtcaccctatcggtgcaagtggtgcgcgcatcttagtc
actttattacacgcaatgcatgcccgtgataaacaattcggtttagcaacgctttgtatc
ggtggtggacaaggcattgccatgatcgttgaacgtatttaa

DBGET integrated database retrieval system