KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_1690Help
Entry
F543_1690         CDS       T03018                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Pathway
btrh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:btrh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    F543_1690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:btrh03011]
    F543_1690
Ribosome [BR:btrh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    F543_1690
  Bacteria
    F543_1690
  Archaea
    F543_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733 TetR_C_22
Motif
Other DBs
NCBI-ProteinID: AHG83033
Position
166970..167302
Genome map
AA seq 110 aa AA seqDB search
METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAALVKKVLESAIANAEH
NDGADVDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgttacgctcgtacttctgcccaaaaagctcgcttagtt
gctgatttaattcgcggtaaaaaagttgcgcaagcactagaaatcttaactttcactaac
aaaaaagcagcagcgcttgttaagaaagtattagaatcagctattgcaaacgcagagcac
aatgacggtgcagatgtcgatgatcttaaagttgctaaaatcttcgttgatgaaggtcca
agcatgaaacgtgtaatgccacgtgctaaaggtcgtgcagatcgtattttaaaacgtact
agccacatcactgtggtagtatcggatcgttaa

DBGET integrated database retrieval system