KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-189: F543_18360Help
Entry
F543_18360        CDS       T03018                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
btrh  Bibersteinia trehalosi USDA-ARS-USMARC-189
Pathway
btrh00450  Selenocompound metabolism
btrh00970  Aminoacyl-tRNA biosynthesis
btrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btrh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    F543_18360
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F543_18360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btrh01007]
    F543_18360
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btrh03016]
    F543_18360
Enzymes [BR:btrh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     F543_18360
Amino acid related enzymes [BR:btrh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   F543_18360
Transfer RNA biogenesis [BR:btrh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F543_18360
 Prokaryotic type
   Other AARSs
    F543_18360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AHG84697
Position
1898056..1898655
Genome map
AA seq 199 aa AA seqDB search
MSNRKILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNQVHFVCADDAHGTPIMLN
ADKQGITPEQLIEKAKADHVADFAGFNISFDNYHSTHSEENKAITRDIYNTLKTNGFIKS
KVISQLFDPEKQMFLPDRFVKGTCPKCKAEDQYGDNCEVCAATYSPTELINPKSAISGAT
PEMKDSEHFFLIYLLLKRC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccgtaaaattcttgttacttgtgccttgccttatgcgaatggcgcaattcac
ttagggcatatgcttgaacatatccaagcggatatttgggtgcgttttcaacgtatgcga
ggcaaccaagtgcatttcgtttgtgcagatgatgcacacggcacgccaattatgcttaat
gccgataaacaaggcattacccctgaacaactgattgaaaaggcaaaagccgatcacgtt
gccgattttgctggctttaatatcagctttgataactatcattctacccacagtgaagaa
aataaagcgatcactcgcgatatctataacaccttaaaaaccaacggttttattaaaagc
aaagtcatttctcagctgtttgaccctgaaaaacagatgttcttgccagaccgtttcgtg
aaaggcacttgcccaaaatgtaaagcagaagatcaatatggtgataactgcgaagtctgt
gcagcaacgtatagcccaacggagttaatcaatccgaaatcagctatttcaggtgcaacc
cctgaaatgaaagactcggaacacttctttttgatttacctgcttttgaagcgatgctaa

DBGET integrated database retrieval system