KEGG   Bordetella trematum: SAMEA390648700037Help
Entry
SAMEA390648700037 CDS       T04322                                 

Gene name
pcaF_1
Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btrm  Bordetella trematum
Pathway
btrm00071  Fatty acid degradation
btrm00072  Synthesis and degradation of ketone bodies
btrm00280  Valine, leucine and isoleucine degradation
btrm00310  Lysine degradation
btrm00362  Benzoate degradation
btrm00380  Tryptophan metabolism
btrm00620  Pyruvate metabolism
btrm00630  Glyoxylate and dicarboxylate metabolism
btrm00640  Propanoate metabolism
btrm00650  Butanoate metabolism
btrm00900  Terpenoid backbone biosynthesis
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01120  Microbial metabolism in diverse environments
btrm01130  Biosynthesis of antibiotics
btrm01200  Carbon metabolism
btrm01212  Fatty acid metabolism
btrm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA390648700037 (pcaF_1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMEA390648700037 (pcaF_1)
   00640 Propanoate metabolism
    SAMEA390648700037 (pcaF_1)
   00650 Butanoate metabolism
    SAMEA390648700037 (pcaF_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMEA390648700037 (pcaF_1)
   00072 Synthesis and degradation of ketone bodies
    SAMEA390648700037 (pcaF_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMEA390648700037 (pcaF_1)
   00310 Lysine degradation
    SAMEA390648700037 (pcaF_1)
   00380 Tryptophan metabolism
    SAMEA390648700037 (pcaF_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMEA390648700037 (pcaF_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMEA390648700037 (pcaF_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMEA390648700037 (pcaF_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btrm04147]
    SAMEA390648700037 (pcaF_1)
Enzymes [BR:btrm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMEA390648700037 (pcaF_1)
Exosome [BR:btrm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMEA390648700037 (pcaF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: SAI65999
UniProt: A0A157S6I4
Position
1:48706..49230
Genome map
AA seq 174 aa AA seqDB search
MPHAHEVQAEPVYIVDGARSPFLKARQGPGPFSAADLAVQAAAGLLLRQPFAASDLDQVI
LGCAAPAADEPNIGRIVALRLGCGDPVTGWTVQRNCASGMQALDSAIADIQRGRSQLVLA
GGTEALSRTPLLFSREAAGWFGRWAGARGPGPAWPCWRACDRVFLRQSSACSRA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttgccccatgcccacgaagtccaggctgagccggtctatatcgtcgacggcgcgcgctcg
ccctttctcaaggcgcgccagggccctggccccttctccgccgccgatctggccgtgcag
gccgcagcaggcctgttgctgcgccagccctttgcggcttccgatctcgaccaggtgatt
ctcggttgcgccgcaccggcggccgacgagcccaacatcggacgcatcgtcgccttgcgc
ctgggctgcggggacccggtgacaggctggacggtccagcgcaactgtgcctcgggcatg
caggcgctggacagcgccatcgcagacatccagcgcggtcgcagccaattggtcctggct
ggcggcaccgaagcgctttcgcgcacccctttgctgttttcccgcgaggccgccggctgg
ttcggccgctgggccggtgcgcgcggccccgggcccgcctggccttgctggcgcgcctgc
gaccgcgtttttttgcgccagtcatcggcctgctcaagggcctga

DBGET integrated database retrieval system