KEGG   Bordetella trematum: SAMEA390648700369Help
Entry
SAMEA390648700369 CDS       T04322                                 

Gene name
ompR_1
Definition
(GenBank) two component response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
btrm  Bordetella trematum
Pathway
btrm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMEA390648700369 (ompR_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:btrm02022]
    SAMEA390648700369 (ompR_1)
Two-component system [BR:btrm02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   SAMEA390648700369 (ompR_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C AHJR-like OKR_DC_1_N FleQ
Motif
Other DBs
NCBI-ProteinID: SAI66658
UniProt: A0A157R9V3
Position
1:355891..356592
Genome map
AA seq 233 aa AA seqDB search
METPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLP
GGDGADACRRLREQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAV
LRRKRGPSALTKDQPVRFGPFVFDPALRQLLRDNEAVKLTGGEINLLEALVRNAGKPLSR
ERLLALARDDESGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFAP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaaactccgcacaccaagctgctggtcgtcgatgacgaccccgccttgcgccaactg
ctggccgactacctgaaccggcatggctacgacaccctgctggcgccggacgccagcgac
ctggccgcccgcatcacgcgctatgcccccgacctgctggtgctcgatcgcatgctgccc
ggcggagatggcgccgatgcctgccggcgcctgcgcgaacagggagaggatatccctgtg
atcctgctgaccgcccgcgacgaggcggtcgatcgcatcatcggcctggaggccggggcc
gacgactacctcggcaagcctttcgatccgcgcgagctgctggcccgcatcgaggccgta
ctgcgacgcaagcgcggcccctcggcgctgaccaaggatcagccggtgcgcttcggcccc
ttcgttttcgacccggcattgcgccagctgctgcgcgacaatgaagcggtcaagctgaca
ggcggcgagatcaatctgctggaagccctggtgcgcaatgccggcaagccgctgtcgcgc
gaacgcctgctggcgttggcgcgcgacgacgaaagcggcgagcgcaatgaccgcgccatc
gatatcgccatcctgcgcctgcgccgcgccatcgaagaagatcccaaacagccgcgctgg
atccagaccgtctggggcatcggctaccgtttcgccccctga

DBGET integrated database retrieval system