KEGG   Bordetella trematum: SAMEA390648701195Help
Entry
SAMEA390648701195 CDS       T04322                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiation protein
  KO
K02313  chromosomal replication initiator protein
Organism
btrm  Bordetella trematum
Pathway
btrm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMEA390648701195 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:btrm03032]
    SAMEA390648701195 (dnaA)
   03036 Chromosome and associated proteins [BR:btrm03036]
    SAMEA390648701195 (dnaA)
DNA replication proteins [BR:btrm03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAMEA390648701195 (dnaA)
Chromosome and associated proteins [BR:btrm03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SAMEA390648701195 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFG1_ATPase AAA_16 ATPase_2 TsaE RuvB_N RNA_helicase DEC-1_N
Motif
Other DBs
NCBI-ProteinID: SAI68327
UniProt: A0A157MT24
Position
1:complement(1269895..1271355)
Genome map
AA seq 486 aa AA seqDB search
MKEFWQTCVSRLEQELPPQQISAWIRPLVPLAFDEAQAVLRVAAPNRFKLDWVRKNFSHQ
IEALATEWYQRPVQVQFELPSHGAAPRMPMTPRPSAAAPVPMPSAPPPAMPSAPAAAPAP
APMAAEPAPSLAQSAAAVEAANIVYERSRLNTDLTFDNFVTGKANQLARAAALQVAENPG
TSYNPLFLYGGVGLGKTHLIHAIGNAMVAAGTGVRVRYVHADQYVSDVVKAYQRKAFDDF
KRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEAMVAQRKQIIITSDTYPKELSGIDSRL
ISRFDSGLTVAIEPPELEMRVAILLRKAESEGVPMPEEVAFFIAKHLRSNVRELEGALRK
VLAYARFHGRDILNVDVCKDALKDLLSVSNGQITVENIQKTVADFYKIKVADMYSKRRPA
NIALPRQVAMYLAKELTQKSLPEIGDLFGGRDHTTVLHAVRKISDARAKQAELNHTLHVL
EQTLKG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattctggcagacctgcgtcagtcgtcttgagcaggagcttcccccccaacaa
atcagcgcgtggataagaccgctggtcccgcttgcctttgacgaagcgcaggcggtgctg
cgcgtggctgcccccaaccgcttcaagctggattgggtccgcaagaacttttcgcatcag
atcgaggcgctggctaccgagtggtatcagcgtccggtgcaggtgcagttcgagttgccc
agccacggcgccgcgccacgcatgcccatgactccccgcccgagcgccgccgcgcccgtg
ccgatgcccagtgcgccaccgccggccatgccgagcgcgccggctgcggccccggcgccc
gcgccgatggccgccgagccggcgccttcgctcgcgcaaagcgcggctgccgtcgaggcc
gccaacatcgtctatgagcgctcgcgactgaataccgacctgaccttcgacaatttcgtc
acgggtaaggcgaaccagctggcgcgtgcggctgccttgcaggtggccgagaatccgggc
acttcctataacccgctgttcctgtatggcggggtcggtctgggcaaaacccacctgatc
catgcgatcggcaacgccatggtggccgccggcaccggggtgcgggtgcgctatgtgcat
gccgaccagtatgtctcggacgtggtcaaggcctaccagcgcaaggccttcgatgatttc
aagcgttactaccattcgctcgatctgctgctgatcgacgatattcagttcttctccggc
aagaaccgcacgcaggaagagttcttctatgcgttcgaggcgatggtggcgcagcgcaag
cagatcatcatcaccagcgacacctatcccaaggagctgtcgggcatcgacagccgtctg
atctcgcgctttgactccggcctgacggtagccatcgagccgccggaactggaaatgcgg
gtcgccattctgttgcgcaaggccgaatccgagggggtgcccatgcccgaggaagtggcc
ttcttcatcgccaagcatctgcgcagcaacgtgcgcgagctcgagggcgcgttgcgcaag
gtgctggcctatgcgcgctttcatggtcgcgacatcctcaatgtggatgtctgcaaggac
gcgctcaaggatctgctgtcggtgtccaacggccagatcacggtcgagaatatccagaag
acggtcgcggatttctacaagatcaaggtggccgacatgtattcgaaacgccggcccgcg
aatattgccttgccgcgccaggtggcgatgtacctggccaaggagttgacccagaaaagc
ctgcccgagatcggtgatctgttcggcggccgtgaccacacgacggtgttgcacgcggtt
cgcaagatttccgatgcgcgtgccaagcaggccgagctcaaccataccctgcacgtgttg
gaacaaactctcaaaggatga

DBGET integrated database retrieval system