KEGG   Bordetella trematum: SAMEA390648701345Help
Entry
SAMEA390648701345 CDS       T04322                                 

Definition
(GenBank) Uncharacterised protein
Organism
btrm  Bordetella trematum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4148
Motif
Other DBs
NCBI-ProteinID: SAI68609
UniProt: A0A157RTE9
Position
1:complement(1429939..1430319)
Genome map
AA seq 126 aa AA seqDB search
MKSFATAALLSLSVMAGAQAADTTPTRAQVQAELEQAKASGQYTFGEEGYPVIVSHGASL
SSAQVQDELAQARNAGQMASSEQAYPPVTAVSAATPDRAHVRAELEQARDAGLVTFGNLD
YPPTHG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattcgccaccgccgccctgctgtccctgtccgtcatggctggcgcccaagcc
gccgacaccaccccgacccgcgcccaggtgcaggccgaactggaacaggccaaggcttcc
ggtcaatacaccttcggtgaagaaggctatccggtgatcgtgtcgcacggcgccagcctg
tcgtcggcccaggtgcaagacgaactggctcaggcgcgcaacgccggccagatggcatcg
agcgagcaggcctacccgcccgtgacggcagtctcggcagccacgcctgaccgcgcccac
gtgcgcgccgaactggagcaggcccgcgacgccggcctggtcaccttcggcaacctggac
tacccgcccacccacggctga

DBGET integrated database retrieval system