KEGG   Bordetella trematum: SAMEA390648703737Help
Entry
SAMEA390648703737 CDS       T04322                                 

Gene name
ispA
Definition
(GenBank) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
btrm  Bordetella trematum
Pathway
btrm00900  Terpenoid backbone biosynthesis
btrm01100  Metabolic pathways
btrm01110  Biosynthesis of secondary metabolites
btrm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btrm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMEA390648703737 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:btrm01006]
    SAMEA390648703737 (ispA)
Enzymes [BR:btrm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SAMEA390648703737 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SAMEA390648703737 (ispA)
Prenyltransferases [BR:btrm01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SAMEA390648703737 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: SAI73518
UniProt: A0A157SSQ3
Position
1:complement(3995553..3996464)
Genome map
AA seq 303 aa AA seqDB search
MKQPHLACADWLRERALHIEQVLKELMPAAQTAPERLHEAMRYAVLGGGKRVRAALVYAA
GQACPVSGSVLAVEASMDRAAAAVELIHAYSLVHDDLPCMDNDTLRRGRPTAHIHYDEAT
AMLAGDALQPLAFELLAGMPIAPALVVQATQVLARAAGSLGMAGGQAIDLHSVGKTLTRD
ELQVMHSMKTGAMLAASVTLGGIVAGASSTARAALDSYAQAMGLAFQVVDDILDVTADSA
SLGKTAGKDAVENKPTYVSLLGLEAAQALAEELRQAAHQALGPLGESGARLGQLADFIVL
RDR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaccccatcttgcctgcgccgattggctgcgcgaacgtgccttgcatattgag
caggtgctcaaagagctgatgcccgcggcgcaaaccgcgcccgaacgcctgcacgaggcc
atgcgctacgccgtgctgggggggggcaagcgcgtgcgcgctgccctggtatacgctgcc
gggcaggcctgcccggtcagcggcagtgtgctggccgtggaggcgtccatggatcgcgct
gcggcggcggttgagctgatccacgcctattcgctggtgcacgatgatctgccctgcatg
gacaatgacaccctgcgccgtggccgtccgactgcccacatccattatgacgaggctacc
gccatgctggccggcgatgcattgcagccgctggccttcgagctgctggcgggcatgccc
atcgcgccggcgctggtcgtccaggccacgcaggtgctggcgcgtgcggccggcagcctg
ggcatggcgggcggacaggcgatcgatctgcacagcgtgggcaagacgctcacccgcgat
gagctgcaggtcatgcacagcatgaaaaccggcgcgatgctggcggccagcgtgacgctg
ggcggcatcgtggcgggggccagctccacggcgcgtgccgcactggacagctacgcgcag
gctatgggcctggcttttcaggtcgtggacgatattctcgatgtcaccgccgacagcgcc
agcctgggcaaaacggcgggcaaggacgcggtcgagaacaaacccacctatgtatccctg
ctgggcctggaggcggcacaagcgctggccgaggaactgaggcaggccgcgcaccaggcg
ctgggcccgctgggcgaatcgggcgcgcggctgggccagcttgccgatttcatcgtattg
cgcgatcgttga

DBGET integrated database retrieval system