KEGG   Kyrpidia tusciae: Btus_0192Help
Entry
Btus_0192         CDS       T01220                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bts  Kyrpidia tusciae
Pathway
bts00220  Arginine biosynthesis
bts00330  Arginine and proline metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01130  Biosynthesis of antibiotics
bts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Btus_0192
   00330 Arginine and proline metabolism
    Btus_0192
Enzymes [BR:bts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Btus_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADG04970
UniProt: D5WS85
Position
175179..176090
Genome map
AA seq 303 aa AA seqDB search
MMVARIEVLGVPLDLGQGRRGVDMGPSAIRYAGLQDRVRALGFEVQDLGNVSVPEPEAKE
IQDPKLKYLPEIERVSEEIAARVSEVLKRGSMPVILGGDHSLAIGSLAGVALAKARVGVI
WFDAHGDMNTQETTPSGNIHGMPLAASLGLGHPGLTRVAGFAPKVRPENVVLVGARSIDE
GEARLIRKSGLRVFTMHEIDRQGIGAVMEEAIRIASRGVDGVHLSLDLDALDPMTAPGVG
TPVRGGITYREGHLAMELLAEAGVLCSVDVVEVNPILDVANRTAEMAVDLLCSALGKKIL
PDS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatggtggccagaatcgaggtcctcggcgtcccgttggatctggggcagggacgccga
ggggtggacatggggcccagtgccattcggtatgcgggtcttcaggaccgagtgagggcc
ctcgggtttgaggtacaggatctcggcaacgtgtcggtgccggaacccgaggccaaggaa
atccaagatccgaagttgaaatatcttccagaaattgaacgtgtcagcgaggagattgca
gccagggtttcggaagtcctcaaacgcgggtcgatgcccgtgatcctcggcggagatcac
agcttggccatcggttctctggccggcgtggcattggccaaggcgcgggtcggggtgatc
tggttcgacgcccatggggatatgaatacccaggaaaccactccctccggcaatatccac
ggaatgcctctggcggcgtctctggggctcggacaccccggtctgacccgggtggcgggg
tttgccccgaaggttcgaccggaaaatgtggttcttgttggcgcccggtctatcgatgaa
ggtgaggcgcgcttgattcggaagtcggggctgcgcgtgttcaccatgcatgagatcgat
cggcagggcattggagcggtgatggaagaggcgatccgcatcgcgtcccggggcgtagac
ggggttcatctgagtttggatttggatgccttggatcccatgaccgccccgggggtggga
accccggtgcggggagggatcacttaccgagaaggacacctggccatggaacttctcgcc
gaagcgggagtcttgtgttccgtagacgtggtggaggtcaacccgatcttggatgtcgcc
aaccggacggccgagatggcggtggacctgttgtgctcggctctggggaaaaagatcctg
ccggattcttga

DBGET integrated database retrieval system