KEGG   Kyrpidia tusciae: Btus_0617Help
Entry
Btus_0617         CDS       T01220                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bts  Kyrpidia tusciae
Pathway
bts00010  Glycolysis / Gluconeogenesis
bts00020  Citrate cycle (TCA cycle)
bts00620  Pyruvate metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01200  Carbon metabolism
Module
bts_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_0617
   00020 Citrate cycle (TCA cycle)
    Btus_0617
   00620 Pyruvate metabolism
    Btus_0617
Enzymes [BR:bts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Btus_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: ADG05380
UniProt: D5WUJ0
Position
608448..609827
Genome map
AA seq 459 aa AA seqDB search
MIYQWRLPDVGEGIHEAEIVRWRVQPGEVVTEDQVLLEVQTDKATVEIPSPVAGKVVEVH
GDEGQVVPVGTVLVEIETEEGQVSPGLRGVAAESGMPAGSATSGVVGRESERQVPPGSPG
TGNGLQRAKAAPVVRRLARELGIDINQVPGTGPGGRVLEEDVRAFAARGGDRDLGGGTSG
PEVQVGEGRSETGAQRLSTAEPKKQETVSPVGAREAEGSFAEGQDADEQRIPLRGVRRVI
AEHMVQSKFTIPHVTGMDEADVTELVAFRRQVEESAAEGQVKITYLPFIVKAVVAGLKAY
PYFNAGLDDERREIVLKRRYHIGIAVDAPDGLLVPIVHDADRKSVLEIAEEIEELKEKAR
SGSLSPDEMRGGTFTISNIGSFGGLFATPIIHYPQAAILATGKIVRRPVMLEDDRVVGRW
MMPISLTFDHRIIDGAAATRFMGYIMQLLGNPMQLMVRI
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccagtggagattgcccgatgtgggggaagggattcacgaggcggaaattgtt
cgttggcgagtgcagcccggtgaggtggtcaccgaggatcaggtgctgctcgaggtccag
acggacaaggcgacggtggagatcccaagcccagttgcgggaaaggtcgtggaggtacat
ggggacgaaggacaggtggtgcctgtcggaacggtgttggtggagatcgagaccgaggag
ggacaagtgtcgccgggactgagaggggttgcggcggaaagcggcatgccggcgggatct
gctaccagtggcgttgtgggccgggaatcggagcggcaggtgccgccgggcagtccgggt
actggcaatggattgcagcgagccaaggcggccccggtggtgaggcggctcgcccgggaa
ctcgggatcgatatcaatcaggtacccgggacgggcccggggggccgagttctggaggag
gacgtgcgggcctttgccgcccggggaggtgaccgggatctggggggcggcacttccggc
ccggaggttcaggttggggaaggtcgttcggagacgggcgctcaaaggttgtccactgcg
gaaccgaagaaacaagagaccgtctccccggtcggcgcccgggaagcagagggttccttc
gctgaagggcaagacgcggacgagcagaggatccctcttcggggggttcgccgggtcatc
gcggaacatatggtgcagtcaaaatttacgatcccccatgtgacggggatggacgaagca
gacgtgaccgagttggtggcgttccggcggcaagtggaggaaagtgcggccgaggggcag
gtcaagatcacgtatctgccctttatcgtgaaggctgtggtggccgggttgaaagcgtat
ccgtatttcaacgcgggtctcgatgacgaacgccgggagattgtcctcaagcgccgctac
cacatcggtattgcggtggacgcgccggatggtctgttggttccgatcgttcacgatgcc
gatcgcaaaagtgtgctggagatcgcggaagagatcgaagagctgaaggagaaggcccgg
tcggggtccttgtctccggacgagatgcggggcgggacgtttacaatcagcaatatcggt
tcgttcggcggcctgtttgccactccgattattcactatccccaggcggcgatcctagcc
acggggaagatcgtccggcggcctgtgatgttggaggatgaccgggtggtggggcgatgg
atgatgccgatttccctgacctttgaccatcgaatcatcgatggggccgcggccactcgg
tttatgggatacatcatgcagcttctcggcaacccgatgcaattgatggttcggatctaa

DBGET integrated database retrieval system