KEGG   Kyrpidia tusciae: Btus_0969Help
Entry
Btus_0969         CDS       T01220                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bts  Kyrpidia tusciae
Pathway
bts00360  Phenylalanine metabolism
bts00362  Benzoate degradation
bts00621  Dioxin degradation
bts00622  Xylene degradation
bts01100  Metabolic pathways
bts01120  Microbial metabolism in diverse environments
bts01220  Degradation of aromatic compounds
Module
bts_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Btus_0969
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Btus_0969
   00622 Xylene degradation
    Btus_0969
   00621 Dioxin degradation
    Btus_0969
Enzymes [BR:bts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Btus_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm AbfS_sensor Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: ADG05708
UniProt: D5WW76
Position
971579..972616
Genome map
AA seq 345 aa AA seqDB search
MEKRTIRVTDVTLRDGMHAVRHQFSAEDARVISRALDETGVAIIEATHGDGLGGSSVQYG
FSKETEEDYLRAVCETVKRSKVAALLLPGIGTVEDMKRAAEYGIRVIRVATHCTEADISE
QHIGEARKMGLETVGFLMMAHMVPAQTLVEEAKKMASYGAQTVYVVDSAGAMLMDEVRQK
VAALREALPEEVEVGFHAHNNLGVSVANSIAAVEAGATRIDASLAGLGAGAGNTPLEVFA
AAAEKAGIETGVNLYAAMDAAEDVVRPRMTRPVQTDRVSLTMGYAGVYSSFLLHAFRAAE
QFGVDARDILVELGKRKVVGGQEDMIVDVAVELARQKKAAVSAGS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcggacgattcgagtgacggatgtgacccttcgggacgggatgcacgcggtg
cgccatcagttcagtgccgaagacgcccgggtgatctcccgggcgttggatgagacggga
gtggcgatcattgaagcgacgcatggagacggtttgggcggcagttcggtccagtacggt
ttttccaaagagacggaagaagactacctgcgggcggtgtgcgagacggtcaagcgcagc
aaagtcgcggccctgcttctgccggggatcggaaccgttgaagacatgaagcgagccgcg
gagtatggaatccgcgtgattcgggtggcgacccactgcaccgaggcggacatttcagag
cagcatattggggaagcgaggaaaatggggttggagacggtgggattcctgatgatggcc
cacatggtgccggcccaaaccctggtggaagaagcgaaaaagatggcctcctacggggcg
cagaccgtgtacgtggtggactcggccggcgccatgctcatggacgaagtgcggcaaaaa
gtggcggctctgcgggaagcgctgccggaggaagtggaggtggggttccacgcccacaat
aacctcggggtgtcggtggccaattccattgccgccgtagaggccggggcgacccggatt
gacgccagcctggcgggtcttggggccggggcggggaacacgcctttggaggtgtttgcg
gcggcggccgaaaaggcgggcatcgagaccggggtgaatctttacgcggcaatggatgcg
gcggaggatgtggtgcgtccccgcatgacgcgaccggtgcagaccgaccgggtgagtttg
accatggggtatgcaggcgtgtattcgagctttttgctgcacgctttccgagcggcggag
cagtttggcgtggatgctcgggacatcctggtggagttgggcaaacggaaggtggtcggc
ggccaggaggacatgatcgtcgacgtggcggtggagctggcgcgccagaagaaagcggcg
gtgtccgccggatcgtga

DBGET integrated database retrieval system