KEGG   Kyrpidia tusciae: Btus_1419Help
Entry
Btus_1419         CDS       T01220                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bts  Kyrpidia tusciae
Pathway
bts00770  Pantothenate and CoA biosynthesis
bts01100  Metabolic pathways
Module
bts_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Btus_1419
Enzymes [BR:bts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Btus_1419
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Btus_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ADG06132
UniProt: D5WP73
Position
1433108..1434319
Genome map
AA seq 403 aa AA seqDB search
MKDREIIVGVTGGIAAYKSAALCSRFVKSGARVHVILTEGAAKFITPLTFQSITKHPVAV
DVFDETDPSVIQHIHLADLADVFVVAPATADILAKAAWGLADDMLSTTLLATRSPVIFAP
AMNVHMFGHPAVQENIARLRARGCVIVDPGEGPLACGYTGKGRMAEPDEIAEVVEAVLNR
RRDFADVRVLVTAGATWEPFDPVRILSNRSTGKMGYAVAEAARDRGATVTLVAGPGELRS
PEGVRLIRVETALEMRDAVLANLPMHDVLIKAAAVSDYRPAVVHPSKVKKAEGPLTVELV
RNPDILMEVSRHRRPDQVIVGFAAETEDVEKNALEKLRRKSLDYIVANDVSMAGAGFAVD
TNIVTIYGRDGTALALPPLSKREVADRLLDVIRDTPGKVGAGS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaccgtgagatcatcgttggggtgaccggaggcatcgccgcctacaagtcggca
gccctgtgcagtcgtttcgtgaaatccggcgccagggttcacgtcattctaaccgaaggg
gccgcgaagttcatcacgcccctgacgttccaaagcattacgaaacaccccgtggcggtg
gacgtattcgacgagacggatccttcggtcatccagcacattcacctggcggatttggcg
gatgtgttcgtggtggcgccggcaacagccgacattctcgcaaaagccgcttgggggctg
gcggatgacatgctgtccaccacgctgctcgccacgaggtctccggtcatcttcgccccg
gcgatgaacgttcacatgtttggccaccctgctgtccaagaaaatatcgcccgcctccgg
gcccggggctgtgtcatcgtcgaccccggggagggccccttggcttgcgggtataccggg
aagggccgcatggcggaacccgatgagatcgccgaagtcgtggaggccgtgttaaaccgc
cgccgggactttgcggacgtccgcgtgttggtgaccgccggtgccacgtgggagcccttt
gatcccgtccggatactgtccaaccgctccaccggcaaaatgggttatgccgtggcggaa
gcggcccgggatcgcggggcaaccgtgaccctagtggcagggccgggagagctccgctcc
ccggagggggttcgcctcatccgggtcgagacggccctggagatgcgggacgctgttctt
gcaaaccttccgatgcatgatgttttaatcaaggccgcggcggtgtcagattatcggccg
gcggtggttcacccctcgaaggtcaaaaaggcggaaggtccgctcactgtggagttggtc
cgcaacccggatattctgatggaagtatccaggcatcgtcgaccggatcaggtgatcgtc
ggttttgccgcggaaacggaagatgtagagaaaaacgctctggaaaagttaagacgcaag
agcctcgactacatcgtcgccaatgatgtctccatggccggggcggggtttgccgtcgat
acgaatattgtgacgatctacggcagggacggtaccgctttggcgcttcctccgctgtca
aaacgggaggtggcagatcgcctcttggacgtgattcgggacaccccgggcaaggtgggg
gcaggatcgtga

DBGET integrated database retrieval system