KEGG   Kyrpidia tusciae: Btus_2318
Entry
Btus_2318         CDS       T01220                                 

Definition
(GenBank) Extradiol ring-cleavage dioxygenase class III protein subunit B
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
bts  Kyrpidia tusciae
Pathway
bts00621  Dioxin degradation
bts01100  Metabolic pathways
bts01120  Microbial metabolism in diverse environments
bts01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Btus_2318
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     Btus_2318
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: ADG06987
UniProt: D5WS35
Position
complement(2346232..2347038)
AA seq 268 aa
MGKIVAAAATSHIMMSSHGVEEQAKNVVEGFRRFGRYIQDARPDVIVCMSSEHMVNLHLD
NMPAFCVGVGDKHMAYGDMDIPKVQVTGHRDFAQSFVQHAFDNEFDLATSEELLLDHGVM
LPLLYANPGMKIPVVVLLTNIMTQPMPSMKRCVKLAQVLRETIETLRPENERVAVIGTGG
LSHWLPPGTGGINEEWDRMLLDVISSGRVEELYDLSTEEIMEKGGNGGQEIRNWIMMASM
VQGRQGRILYYEAPQSWATGMGSVVMEV
NT seq 807 nt   +upstreamnt  +downstreamnt
gtgggaaaaattgttgcggcagcggctacttctcatatcatgatgagcagtcacggagtg
gaagaacaggccaagaatgttgttgaaggatttcggcgctttgggcgctacattcaagat
gctaggccggatgtcattgtttgcatgtccagcgaacacatggtcaatcttcatttggat
aatatgccggcgttttgtgtaggtgtcggtgacaagcacatggcgtacggagacatggat
atccctaaagttcaggtaaccgggcaccgggattttgcacaaagttttgtacaacatgct
tttgacaacgaatttgatctggcaacttctgaagaactattgctggatcacggtgtgatg
ttgccgttgctctacgccaatccgggaatgaagattcccgttgtcgtccttctcaccaat
attatgactcaacctatgcccagcatgaaacggtgcgtaaagttggcgcaggttttgcgc
gagaccattgaaacgttgcgtccggagaacgaaagggttgcggttattgggaccggtggc
ctttcccactggcttccgcctggaaccggcggcatcaatgaagagtgggatcgcatgctg
ttggatgtgatctcttccgggcgtgtggaggaactctacgatctttcgactgaagaaatt
atggaaaaagggggcaatgggggccaggagattcgcaactggatcatgatggcttccatg
gttcagggtaggcaagggagaattctgtactatgaagctccccagtcctgggcaacggga
atgggcagcgtggtcatggaagtttga

DBGET integrated database retrieval system