KEGG   Kyrpidia tusciae: Btus_2744Help
Entry
Btus_2744         CDS       T01220                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bts  Kyrpidia tusciae
Pathway
bts00970  Aminoacyl-tRNA biosynthesis
bts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bts00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Btus_2744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bts03029]
    Btus_2744
Enzymes [BR:bts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Btus_2744
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Btus_2744
Mitochondrial biogenesis [BR:bts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Btus_2744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADG07393
UniProt: D5WUE1
Position
complement(2810958..2812304)
Genome map
AA seq 448 aa AA seqDB search
MTDYMTVLEMLSALERGTMTREALATRVRERLNVLEPKVQAFLYVDPEAADRIADPPGSG
PLSGIPVGVKDMIDVAGMPTTGGSRAYHRMPAEDAPCVAKLRKAGAVIVGKTNTQELAYG
VITPPTRNPRNLDYIPGGSSGGSAAAVAAGMVAAALGTDTGGSVRIPASCCGIVGFKPTR
DRISTQGVMPLSTTYDHVGLLTHTASDARYLFHLLTEHPGDSPIRAADGRTERPRPGGRA
SHDRVLAVPWDYIRERTDPEIVQIFEDVLGVFRRLGYGFEAVEMEPFDEWKALQLTVRLP
EAYLTHREVLEGPRRGLLQRDLAERLDPGRDISALDYLAAQAIRREKIADWTRKMESYAG
LVMPTLPCPVPKVGQEQVRIPGSEVPVWDALVSMTAPWNVVGFPAVSVPCGVDSRGLPVG
LQVVGSPMDDDGLLDLAAQFQAAAGIRL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacagattatatgactgttctcgaaatgttatctgctttggaaagaggtacgatgacc
cgcgaggcattggccacccgggttcgggaacgactgaacgtcctggagccgaaggttcag
gcgtttttatatgtggatcccgaggcggcggatcgcattgcggatccccccgggtctggc
ccgctgtccgggatacctgtgggcgtgaaagacatgatcgacgtcgccggcatgccgacg
accgggggttcccgcgcctatcaccggatgccggccgaggacgccccatgcgtggccaaa
cttcggaaagccggggcggtgatcgtcgggaagaccaacacccaggagttggcctacgga
gttattacccctcccacccgcaatccccgcaacctcgactacattcccgggggctcaagc
ggaggctcggctgcagcggtggccgcggggatggttgcggcagctctggggacggatacc
ggcggttccgttcgcattccggcatcgtgttgcgggatcgtcggctttaagccgacaaga
gaccgaatttccacccaaggggtgatgcccctcagcaccacctacgaccacgtggggctc
ctcacccacaccgcctccgatgctcgctacttatttcatttactgactgagcatcctggg
gattccccgattcgcgctgcggatgggcgcactgaacgtcccagacccggagggcgggct
tctcacgaccgcgtcctcgccgtgccctgggactacatccgcgagaggacagatccggaa
atcgttcaaatattcgaagatgtcctcggcgttttccggcgtttggggtatggatttgaa
gccgtggagatggagccctttgacgagtggaaagcgcttcaacttaccgttcgccttccc
gaggcgtatctcacccaccgggaggtgctcgaggggccccggcggggactgctccagagg
gatctcgctgaacggttagatcccgggcgggacatttccgccctggactatttggcggcc
caagcgattcggagggagaagatcgccgattggacccggaaaatggaaagctacgccggg
ctcgtgatgccgactttgccctgccccgttcccaaggtgggtcaagagcaggtgcggatc
ccgggcagtgaagtacctgtttgggatgcgctggtgtccatgactgcgccgtggaatgtg
gtgggatttcccgccgtgtcggtgccctgcggggtggatagccgaggattgcccgtcggt
ctccaggtggtcggttcgcccatggacgacgacggattgctggatctggcggcgcaattc
caagccgccgccgggattcggctatga

DBGET integrated database retrieval system