KEGG   Kyrpidia tusciae: Btus_2794Help
Entry
Btus_2794         CDS       T01220                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bts  Kyrpidia tusciae
Pathway
bts00051  Fructose and mannose metabolism
bts01100  Metabolic pathways
bts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Btus_2794
Enzymes [BR:bts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Btus_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADG07439
UniProt: D5WUW7
Position
complement(2866695..2867363)
Genome map
AA seq 222 aa AA seqDB search
MDKVSRAKTELIQASRALRDAGLMFRGYHANLSARISEDEMILTKGGNVAHLDEDSFAVV
RIDGTVLEGEVAPAQAEIIQMHAAVYRERASVGSVIHTHAPHATVFAVAHQPIPIVYEPL
VRFGVTDAIPVVPWAPRGSDASVNGIIDIVRGHPGVSAVLLANHGVLVFSRTPAEAVQLL
ATLDEAAELILNARLIGGEKRLPNEAFEQIEQRMREFAGAEK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtctctcgggctaaaaccgagttgattcaagcgtctcgggcgttgcgagat
gcaggcttgatgtttcgcgggtatcatgccaacttgtcggcacggatctccgaagatgag
atgatcttgacaaagggcggcaatgttgcccatctcgacgaggacagttttgcagtggtt
cgcatcgacggcactgtccttgagggagaagttgccccagcccaagcggagattatccag
atgcatgccgcggtctatcgcgagcgtgcttcggtcggcagcgtcatccatacccatgcg
cctcacgccacagtctttgccgtcgcccatcaaccgatcccgattgtttacgaacccttg
gtccgcttcggagtgaccgacgccattccggtcgtaccatgggcgccgcgggggtcggac
gcttcggtaaacggcattatcgatattgtgaggggacatccgggggtatcggcggtgctc
ttagcgaatcacggcgtgctcgtgttttcgcgtacccctgctgaagcggttcagttgctg
gccactctcgatgaggcagccgaattgattttgaacgcgcggttgatcggcggagaaaag
cgcctgcccaatgaggcctttgaacagattgaacagcggatgcgagaattcgctggtgcc
gagaagtaa

DBGET integrated database retrieval system