KEGG   Kyrpidia tusciae: Btus_3277Help
Entry
Btus_3277         CDS       T01220                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bts  Kyrpidia tusciae
Pathway
bts00071  Fatty acid degradation
bts00072  Synthesis and degradation of ketone bodies
bts00280  Valine, leucine and isoleucine degradation
bts00310  Lysine degradation
bts00362  Benzoate degradation
bts00380  Tryptophan metabolism
bts00620  Pyruvate metabolism
bts00630  Glyoxylate and dicarboxylate metabolism
bts00640  Propanoate metabolism
bts00650  Butanoate metabolism
bts00900  Terpenoid backbone biosynthesis
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01200  Carbon metabolism
bts01212  Fatty acid metabolism
bts02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Btus_3277
   00630 Glyoxylate and dicarboxylate metabolism
    Btus_3277
   00640 Propanoate metabolism
    Btus_3277
   00650 Butanoate metabolism
    Btus_3277
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Btus_3277
   00072 Synthesis and degradation of ketone bodies
    Btus_3277
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Btus_3277
   00310 Lysine degradation
    Btus_3277
   00380 Tryptophan metabolism
    Btus_3277
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Btus_3277
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Btus_3277
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Btus_3277
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bts04147]
    Btus_3277
Enzymes [BR:bts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Btus_3277
Exosome [BR:bts04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Btus_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADG07885
UniProt: D5WXA4
Position
complement(3338953..3340143)
Genome map
AA seq 396 aa AA seqDB search
MARRTAVVGAARTPFGKLGGALAAKKAVELGAAAIRGAMDRAGVGPDEVDELIMGMVLQG
GAGQIPSRQAARLAGLPWELPTETINKVCASGLRAVTLGDQIIRAGDARAVVAGGMESMS
QAPYAVFGAREGLRMGHGRMVDLMIYDGLWCAFHDVHMAALGSRVAGEYGISREDQDLWA
LRSHRRAVAAMDAGRLGEEIVPVEVQEKRGVRRVEQDEAPRRNTSLEQLAVLPPVFTKDG
TVTAGNAPGVNDGAGALVLMDEETARSEGKEVLAVIHGHAEVGAEAAYIATTPALAIQKL
LKKAGRRLEDIRLFEINEAFAAVVLTSAKLLEMSPDVLEEKVNVNGGAVALGHPIGASGA
RILMTLIYELRRRGGGLGVAAICSGAAQGDAILIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcacggcgaacagcggtggtgggggcggctcggacgccctttggcaagctcggcggg
gcactggcggcgaaaaaagcggtggagctcggcgccgcggcgattcgcggggcgatggac
cgggcgggggtgggcccggatgaggtggacgaactcattatggggatggtgcttcagggc
ggggcgggtcagattccgtcccgacaggcggcccggctggcgggacttccttgggagctc
ccgacggagacgatcaataaagtgtgcgcttcgggacttcgggcggtgaccctcggggac
cagatcatccgggccggggacgcccgcgccgtggtggccggcgggatggagagcatgtcc
caggctccttatgccgtttttggagcccgggaagggttgcgcatgggtcacgggcggatg
gtggatctcatgatatacgatggactctggtgtgcctttcacgacgtgcacatggcggcc
ttgggcagccgagtggccggtgagtacgggatctcccgggaagaccaggacctatgggcg
ctgcgcagtcaccgccgggcggtggcagccatggacgccggccggctgggcgaggagatc
gtaccggtggaggttcaggagaagcggggtgtccgccgggtggaacaggatgaagcgccc
cggcgaaacaccagtctggaacaactggcggttctgccgccggtcttcaccaaggatggg
acggtgacggcgggcaatgccccgggggtgaacgacggggccggagctctggttttgatg
gacgaggagacggcccggtcggaaggcaaagaagtgctcgccgtgatccacggccacgcc
gaggtgggggcggaagcggcgtacattgccaccaccccggcgctggcaatccagaagttg
ctgaaaaaagccgggcggcgcctggaggacatccggctgtttgaaatcaatgaggccttt
gcggcggtggtgttgacaagcgccaagcttttggagatgtccccggacgttctggaggag
aaggtcaacgtcaatgggggcgccgtggccctcgggcatcccatcggagccagcggggcg
cggattctcatgaccctcatttatgaacttcggcgccggggtgggggccttggcgttgcc
gcgatctgcagcggggcggcccaaggagacgcgattctgatcgaggtttga

DBGET integrated database retrieval system