KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_0462Help
Entry
HD73_0462         CDS       T02460                                 

Definition
(GenBank) Class II aldolase/adducin
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00051  Fructose and mannose metabolism
btt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HD73_0462
Enzymes [BR:btt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HD73_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGE76042
Position
453202..453843
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVIEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLADAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaaggggacgggtggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtactatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtaatagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacattctccttac
gcgaagacgattgcgtcattaggatgggagcttccggctgtgtcatatttaattgctttt
gcaggtccgaatgtccgctgtgcgccgtatgaaacatttggtacgaagcaattagcggat
gctgcttttgaaggcatgattgatcgtcgtgctgtgctacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcatttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcaacagtag

DBGET integrated database retrieval system