KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_0569Help
Entry
HD73_0569         CDS       T02460                                 

Definition
(GenBank) PTS system, N-acetylglucosamine-specific IIBC component
  KO
K02803  PTS system, N-acetylglucosamine-specific IIB component [EC:2.7.1.193]
K02804  PTS system, N-acetylglucosamine-specific IIC component
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00520  Amino sugar and nucleotide sugar metabolism
btt02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_0569
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HD73_0569
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btt02000]
    HD73_0569
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.193  protein-Npi-phosphohistidine---N-acetyl-D-glucosamine phosphotransferase
     HD73_0569
Transporters [BR:btt02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   N-Acetylglucosamine-specific II component
    HD73_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: AGE76149
Position
563675..565177
Genome map
AA seq 500 aa AA seqDB search
MLQFLQRIGKALMLPIAVLPAAGLLLRLGQPDVFDIPVMAQAGAAVFDNLALIFAIGIAI
GLSVDGSGAAGLAGAIGYLVMKNSIDALSKGYSTAELQGKLGKVQDLIGNSANVDPSKLA
DTMTQVSKAAELSTKVDMKVLGGIIVGVIAGLLYNKFHKIKLPEWLGFFAGKRFVPIVTS
VVMLILGILFAQIWPTIQNGIDALAHGIVNLGAIGSGLFGLLNRLLIPIGLHHVMNTYFW
FVFGDFTNAAGNVVNGDIARFLAGDKTAGMFMTGFFPVMMFGLPAACFAMIAAAKPEKRK
AVTGMLAGLALTSFLTGITEPIEFSFMFLSPVLYGIHAVLTGLSLFITTSLGIHDGFSFS
AGAIDYALNFGIATKPVLLAGIGLIYAAIYFIVFYFLIKKFDLKTPGREDDDELVEDGDA
PVAGSIGETYVAALGGKENLTVIDNCATRLRLQVKDAGQVNEAALKRAGAKGVMKLSNTS
VQVIVGTNVESVADDMKKHV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagtttttacaacgtattggtaaagctttaatgcttccgattgcagtactacca
gcagcaggattattgcttcgtttagggcaaccagatgtatttgatattcctgttatggca
caggccggcgcagcagtttttgataacttagcacttatttttgcaattggtattgcaatc
ggtctttcagtggatggtagtggtgcagcaggtcttgcaggtgcaattggttatcttgtt
atgaaaaatagtattgatgcacttagcaaagggtattcaactgctgaattacaaggtaaa
ttaggtaaagtccaagatttaataggtaatagcgcaaatgtagatccatctaagcttgcg
gatacaatgacacaagtatctaaggctgctgaattatcgactaaagtagatatgaaagtc
ttaggtggtattattgttggtgttatagcaggacttctttataataaattccataagatt
aaacttccagaatggttaggtttctttgctggaaaacgtttcgttccaattgttacatca
gttgtgatgctgatattaggaattctatttgcacaaatttggccaacaattcaaaatggt
attgatgcattagctcatggaattgttaatttaggtgcaattggttcaggactatttggt
ttattaaaccgtttattaatcccaattggtttacaccacgtaatgaacacatacttctgg
tttgtatttggggactttacaaatgcagcaggtaatgttgttaatggtgatattgctcgt
ttccttgcaggtgacaaaacagcaggtatgtttatgactggtttcttcccagttatgatg
ttcggtttaccagcagcatgtttcgcaatgattgcagctgctaaaccagaaaagcgtaaa
gcagttactggtatgttagctggtctagcattaacttcattcttaactggtattacagag
cctattgaattctcattcatgttcttatcaccagtattatatggtattcatgctgtatta
acaggtctttctttattcattacaacatcgcttggcattcatgatggtttctcatttagt
gccggtgcaatcgattacgctttaaacttcggtattgcaacaaaaccagtcttactagca
ggtattggtttaatttacgcagcaatttatttcatagtattctacttcttaattaagaag
ttcgatttaaaaactcctggtcgtgaagatgacgatgagttagttgaagatggtgatgca
ccagttgcaggttcaattggtgaaacttacgtagcagctttaggcggaaaagaaaactta
acagttattgataactgtgcaacacgtctacgcttacaagtaaaagatgctggtcaagta
aatgaagcagcattaaaacgtgctggtgcaaaaggtgttatgaaattaagtaatacaagt
gtacaagttatcgtaggtacaaatgttgaatctgttgccgatgatatgaaaaaacacgta
taa

DBGET integrated database retrieval system