KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_3623Help
Entry
HD73_3623         CDS       T02460                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_3623
Enzymes [BR:btt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     HD73_3623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 3Beta_HSD adh_short Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AGE79201
Position
3468386..3469411
Genome map
AA seq 341 aa AA seqDB search
MASSSFWNKKKVFITGHTGFKGSWLTLFLSSLGAEVVGFSSHPPSIPNIFEQGNVAKECT
TMKGNITDYHSLFHAMKQHKPDIIFHLAAQPIVTASYKNPIDTFKTNVLGTVHVLEAAKS
VESVRAIINVTSDKCYENDGSGDRSFVENDRLGGFDPYSASKACAEILATSYQKSFFRTN
TQKLASVRAGNVIGGGDWAEDRLFPDIIRAYLHNHTLCIRNKYAVRPWQHVLDPLHGYIL
LAEKLWNDAKYAEAWNFGPMNEPNRTVHDVIESVIKLWNNPLTIISSSTNTPYESPVLTL
DSTKAVNKLSWTPKLSTDDSIAWTVDWYKKYASGENIESFT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcatctttttggaataagaaaaaagtatttattacgggacatactggattt
aaaggctcctggctcacccttttcttaagttctttaggtgcagaagtagtaggcttttct
tctcatcccccatccattcctaacatttttgaacaaggtaacgtagcaaaagagtgcacg
acaatgaaaggcaatattacagattaccattctttatttcatgccatgaagcagcataaa
cctgacataatatttcatttagcagctcagccaatcgtaaccgcttcatacaaaaaccct
atcgatacattcaaaacgaatgttttaggtactgttcacgtgctagaagcagcaaagtcc
gtcgaaagcgtacgtgccattattaatgtgacaagcgataaatgttatgagaatgacggt
agtggcgaccgatcgttcgtggaaaatgaccgactaggaggtttcgacccttatagcgct
agtaaagcttgcgctgaaatattggcaacatcctatcaaaaatcattcttccgcactaat
acccagaaactcgcctcagtcagagctggtaacgtcatcggcggtggtgattgggcagaa
gatcgattattccctgatatcattcgggcatatttgcacaatcatactttgtgtattcga
aacaaatatgccgtccgtccgtggcaacatgttttagatcctctacatggctatatcctt
ttagctgagaaactttggaatgatgctaaatatgcagaagcgtggaatttcggcccaatg
aatgaacctaacagaaccgttcatgatgtcattgaatctgtaataaaattatggaataac
ccactaacaatcatttcctcctctacaaatactccttatgaatcacctgttttaacactc
gatagtacaaaagcagtaaacaaactcagctggactcctaagttatcaacagatgattct
atcgcttggactgttgattggtacaaaaaatatgcatctggtgaaaatatagaatctttc
acatga

DBGET integrated database retrieval system