KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_3774Help
Entry
HD73_3774         CDS       T02460                                 

Definition
(GenBank) glucose-1-phosphate cytidylyltransferase
  KO
K00978  glucose-1-phosphate cytidylyltransferase [EC:2.7.7.33]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00500  Starch and sucrose metabolism
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HD73_3774
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_3774
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.33  glucose-1-phosphate cytidylyltransferase
     HD73_3774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AGE79352
Position
3620638..3621387
Genome map
AA seq 249 aa AA seqDB search
MKVIILCGGKGLRMQGILEDIPKPLVRVQGKPLLLHIMNWYRKYGHSDFILPLGYKGEKI
KEYFMDFSWKENDFSLNFKTSQYTLLQKLENWNIHFIDTGIDTMTGARLKKLESFVQGET
FLLTYGDGLANIDIDQLIAFHKEKGKIATLTGIKKNSQYGLLAVEDGIAIDFKEKPLLDE
VINGGFFVFNKEIFDYLSNNDDCVLEEDPLRNLIKDNELAVYEHNDFWASVDTPKDLKTV
NESWNPNKF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcataattttgtgtggcggaaaagggcttcggatgcaaggaattttagaggac
attcccaaaccattagttcgagttcaaggaaagcctctcctcttgcatataatgaattgg
tatagaaaatatggacattctgatttcattttgcccttaggatataaaggtgagaaaatt
aaggaatattttatggactttagctggaaagagaatgactttagtttgaattttaaaacc
agtcaatatacgctacttcagaaattagaaaattggaatatacactttatagatacagga
attgatacaatgaccggggcaagactaaaaaaacttgaatcctttgtacagggtgaaacc
tttttattaacttatggtgacggattagccaatatagatattgatcaactaatagcattc
cataaagaaaaaggaaaaattgctacattaactggaattaaaaaaaatagtcaatacggc
ctattggcggtcgaagatggaattgctattgattttaaagaaaaaccattacttgatgaa
gtaattaatggcggtttttttgtatttaacaaagaaatattcgattatttaagtaataat
gatgattgtgttctagaagaagatcctcttcgaaatttaataaaagacaatgagctcgca
gtctatgaacacaatgacttttgggctagtgtcgatacacctaaagatttaaaaactgta
aatgaaagttggaatccaaataaattttag

DBGET integrated database retrieval system