KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4251Help
Entry
HD73_4251         CDS       T02460                                 

Definition
(GenBank) hypothetical protein
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3055
Motif
Other DBs
NCBI-ProteinID: AGE79829
Position
complement(4114147..4114443)
Genome map
AA seq 98 aa AA seqDB search
MFEKLYDEHESVKVRFLGFMTHDTRYDFGVIYTNMFFGKPLIVCMQTGRSTLLGRDDVEN
VQYIQEIFKLGSEEEAKELAQFFKFLVPSTSLHAEYEE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaattgtatgatgagcatgaaagtgtgaaggtacgatttttagggtttatg
acacatgatacacgttatgattttggtgttatttatacaaatatgttttttggaaagccg
ctcattgtttgtatgcaaacaggaaggtctactttactcggacgagatgatgtagagaat
gttcaatatatacaggagatttttaaattaggatcagaagaggaagcaaaggagttagct
cagtttttcaaatttctagttccgtcaacttctttacatgcggaatatgaagaataa

DBGET integrated database retrieval system