KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4263Help
Entry
HD73_4263         CDS       T02460                                 

Definition
(GenBank) Cytochrome d ubiquinol oxidase, subunit II-like protein
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00190  Oxidative phosphorylation
btt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HD73_4263
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HD73_4263
Enzymes [BR:btt01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     HD73_4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGE79841
Position
complement(4125767..4126633)
Genome map
AA seq 288 aa AA seqDB search
MQISSAILCFVLYAYVIIAAVYFGISFYAYRLVDNNEYDETYKWVKRYLSPVLEIMNGFV
LFLFIGLIAFSTSLVGNKTTLFVLGIIIFMLLGIRIGNTVFWDERKVDGWTGMLIPCMLA
AIVTNIEHEYYQLHFWLIIVLTILSVLYISTVVLTYIAHEKGDVKGTRFFRGRALFWSVP
TMAVIALIAILVNGYQFSNWQLFLENWWIFIFSFIAFLGATHYLFHQHHYIWALLFAFTQ
LLFAFFGQETLLFVFETFSSFGNIFVFAMLLVGIAFYLQQYFYIQKQK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaattagcagtgcgattttatgtttcgtcttatatgcgtatgttattattgcggcg
gtttattttgggataagtttttatgcctatcgtctagtagataataatgaatatgacgaa
acatacaaatgggtgaagagatatttatcacctgtactagaaattatgaatgggtttgtg
ctctttttatttattggattaattgctttctcaacgagtttagtagggaataaaactacg
ttatttgtattgggtatcattatttttatgttgttaggaataaggattggtaatacggtc
ttttgggatgaaagaaaagtagatggttggacgggaatgttaattccgtgcatgttagct
gcaatcgtgacaaatatagagcatgaatattatcaattacatttttggcttattatcgtt
ttaacaattctttctgttttgtatataagcacagtagtactaacatatattgcacatgaa
aaaggagatgttaaaggcactcgtttctttagaggacgggcattattttggagtgtgccg
acgatggcagttatcgcgcttattgcgatattagtaaatggatatcaattttctaattgg
caactatttttagaaaattggtggatctttatcttttcgtttattgcttttttaggtgca
acgcattatttattccatcaacatcattacatatgggcgttgttatttgcattcacacag
cttctatttgccttttttggtcaagaaacattattattcgtttttgaaacatttagttct
tttggaaatatatttgtatttgctatgctacttgttggtatcgctttttacttgcaacaa
tatttttatatacaaaaacaaaaataa

DBGET integrated database retrieval system