KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4265Help
Entry
HD73_4265         CDS       T02460                                 

Definition
(GenBank) tetrahydrodipicolinate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00300  Lysine biosynthesis
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01230  Biosynthesis of amino acids
Module
btt_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HD73_4265
Enzymes [BR:btt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     HD73_4265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 Fucokinase Acetyltransf_11
Motif
Other DBs
NCBI-ProteinID: AGE79843
Position
complement(4128074..4128796)
Genome map
AA seq 240 aa AA seqDB search
MKMMDANEIISFIQKSEKKTPVKVYIKGDLKEVTFPETVQAFVNKKSGVLFGEWSEIKTI
LDENNKHIVDYVVENDRRNSAIPMLDLKGIKARIEPGAIIRDHVEIGDNAVIMMNATINI
GAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDVVIGANVVV
LEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTEIKQELRQLNPEK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatggacgctaacgaaattatttcgtttattcaaaaaagtgaaaagaaaact
cctgtaaaggtatacataaaaggggatttaaaagaagtaacattccctgaaacagtacaa
gcatttgtgaataaaaagtcaggtgtattattcggagaatggtctgaaattaagacaatt
cttgatgagaataataagcacatcgttgactacgttgtagaaaacgatcgtcgtaattct
gcaatcccgatgcttgatttaaaaggtattaaagctcgcatcgagccaggtgctattatt
cgtgaccatgttgaaattggtgacaacgctgtaattatgatgaatgcaacaattaacatt
ggtgctgtaattggtgaaggttctatgatcgacatgaacgcagtacttggtggacgtgca
acagtcggtaaaaactgtcacgtaggtgcaggtgctgtacttgcaggtgttattgagcca
ccttctgcaaaaccagttatcgttgaagatgatgtagtaatcggtgcaaacgtggttgtt
ttagagggtgttacagtagggaaaggtgcagtcgtagcagcaggagctgttgtaacagaa
gatgtgcctccatacacagttgttgcaggtactccagcacgtgtaattaaagaaattgat
gagaagacaaaagcaaaaacagaaattaaacaagagcttcgtcaattaaacccagagaaa
taa

DBGET integrated database retrieval system