KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4272Help
Entry
HD73_4272         CDS       T02460                                 

Definition
(GenBank) NRDH-redoxin
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin Thioredoxin_3 Thioredoxin_4 GST_N_3 DUF836 DSBA Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: AGE79850
Position
4132313..4132549
Genome map
AA seq 78 aa AA seqDB search
MKKIEVYTQPDCPPCVIVKEFLKHNNVAYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDG
EVVAGFQIEKLQQLLNIE
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgaggtttatacacaacccgattgtccgccctgtgttattgtgaaagaa
tttttgaagcataataacgttgcatatgaagaatttgacgtaaaaaaagacgctgctgct
cgcaatcgtcttttatacgactatgattcttattcaactccaacagtcgtaattgatggc
gaagtagttgcagggtttcaaattgaaaagttacaacaactactcaatatagaatag

DBGET integrated database retrieval system