KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4304Help
Entry
HD73_4304         CDS       T02460                                 

Definition
(GenBank) hypothetical protein
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3997
Motif
Other DBs
NCBI-ProteinID: AGE79882
Position
4166467..4166898
Genome map
AA seq 143 aa AA seqDB search
MKKWIILFVAFLLTGCTGNTGHLTYTVNDEYELIRTSGNAFELFPSQDAVYATQYIPAKI
TDIAWDDKYIIAKQTEEKSDPNNPDAAIANKKSEHYWIIDVKHNKRFGPYNEKQFNEQKD
AFKIKVPFQNVDSYIKEIKKQSA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatggataatcctattcgtcgccttcctattaactggttgtacaggaaacaca
ggtcacttaacttatacggttaacgatgaatacgaactcatacgtacttctggaaatgca
tttgaacttttcccctcgcaagatgctgtatatgccacacaatacatccctgcaaaaatt
acagacattgcttgggatgataaatacattattgcaaaacaaaccgaggaaaaatcagat
ccgaataaccctgacgcagcaattgcaaataaaaaaagtgaacattattggattattgac
gtaaagcacaataaacgtttcggtccctacaatgaaaagcaatttaatgaacaaaaagat
gcgtttaaaattaaggtgccttttcaaaatgtagattcatacataaaagaaataaaaaaa
cagtcagcataa

DBGET integrated database retrieval system