KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4309Help
Entry
HD73_4309         CDS       T02460                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00071  Fatty acid degradation
btt00072  Synthesis and degradation of ketone bodies
btt00280  Valine, leucine and isoleucine degradation
btt00310  Lysine degradation
btt00362  Benzoate degradation
btt00380  Tryptophan metabolism
btt00620  Pyruvate metabolism
btt00630  Glyoxylate and dicarboxylate metabolism
btt00640  Propanoate metabolism
btt00650  Butanoate metabolism
btt00900  Terpenoid backbone biosynthesis
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01120  Microbial metabolism in diverse environments
btt01130  Biosynthesis of antibiotics
btt01200  Carbon metabolism
btt01212  Fatty acid metabolism
btt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HD73_4309
   00630 Glyoxylate and dicarboxylate metabolism
    HD73_4309
   00640 Propanoate metabolism
    HD73_4309
   00650 Butanoate metabolism
    HD73_4309
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HD73_4309
   00072 Synthesis and degradation of ketone bodies
    HD73_4309
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HD73_4309
   00310 Lysine degradation
    HD73_4309
   00380 Tryptophan metabolism
    HD73_4309
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HD73_4309
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HD73_4309
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HD73_4309
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:btt04147]
    HD73_4309
Enzymes [BR:btt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HD73_4309
Exosome [BR:btt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HD73_4309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGE79887
Position
complement(4169427..4170602)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGHFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacagcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggagtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggacactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgagcatccacgtgca
gatattacagcggaaaaattagcaggattaaaaccagcattccgtaaagatgggtctgta
actgcaggtaatgcatctggcctgaatgacggaagtgcagttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagacccgaaaattatgggtattggaccagcaccagcaattcgtaaaggtttagaa
aaagtagattggtcattggaagatgcagatttacttgaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggcttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtgggttagaaaaaggaattgcctctttatgcgtcggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system