KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4335Help
Entry
HD73_4335         CDS       T02460                                 

Definition
(GenBank) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase
  KO
K08965  2,3-diketo-5-methylthiopentyl-1-phosphate enolase [EC:5.3.2.5]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00270  Cysteine and methionine metabolism
btt01100  Metabolic pathways
Module
btt_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HD73_4335
Enzymes [BR:btt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.5  2,3-diketo-5-methylthiopentyl-1-phosphate enolase
     HD73_4335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N ALAD DeoC
Motif
Other DBs
NCBI-ProteinID: AGE79913
Position
4192919..4194163
Genome map
AA seq 414 aa AA seqDB search
MSGIIATYLIHDDSHNLEKKAEQIALGLTIGSWTHLPHLLQEQLKQHKGNVIHVEELAEH
EYTNSYLRKKVKRGIIKIEYPLLNFSPDLPAILTTTFGKLSLDGEVKLIDLTFSDELKKH
FPGPKFGIDGIRNLLQVHDRPLLMSIFKGMIGRNIGYLKTQLRDQAIGGVDIVKDDEILF
ENALTPLTKRIVSGKEVLQSVYETYGHKTLYALNLTGRTFDLKENAKRAVQAGADILLFN
VFAYGLDVLQSLAEDDEIPVPIMAHPAVSGAYSASKLYGVSSPLLLGKLLRYAGADFSLF
PSPYGSVALEKEEALAISKYLTEDDAFFKKSFSVPSAGIHPGFVPFIVRDFGKDVVINAG
GGIHGHPNGAQGGGKAFRTAIDATLQNKPLHEVDDINLHSALQIWGNPSYEVKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaattatagcgacgtatttaatccatgatgattcacataacttagaaaaaaaa
gctgagcaaattgcactcggtttaacaattggctcttggactcatttgccacacttattg
caagaacaattaaagcagcataaaggcaacgtcattcatgttgaggaattagctgaacat
gaatataccaattcgtatttacgtaaaaaagtaaaacgcggaattattaaaatcgaatat
ccgctattaaacttcagtccagatttaccagcgattttaacgactacatttggaaagcta
tcacttgatggcgaagtaaaactaattgacttaactttttcagacgagttaaaaaaacat
tttcctggtccaaaattcgggatagatggtattcgaaatcttttacaagtgcatgatcgt
ccccttttaatgagtatttttaaaggaatgattggacgaaacattgggtatttaaaaaca
caattacgcgatcaagcaattggtggtgtagatatagtaaaagatgatgaaatattattt
gaaaatgcattaacaccacttacgaaacgcattgtatctggaaaagaagttttacaatct
gtctacgaaacatacggtcataaaacgttatatgccttaaatttaacaggacgaactttt
gatttaaaagaaaatgctaaacgtgcagtgcaagctggagctgatattctattatttaac
gtatttgcttacggactagatgtactacaatcacttgcagaagatgatgaaatcccagtt
cctattatggcacatcctgctgtaagtggtgcttattcagcatccaagttatatggagtt
tcatcaccattattacttggaaagctactacgttatgctggggctgacttttcattattc
ccatctccatacggaagtgttgcgctagaaaaagaggaggctcttgctatctcaaaatat
ttaactgaagacgatgcatttttcaagaagagcttttctgttccgtctgctggtattcat
cctggtttcgttccctttattgtacgagatttcggtaaagatgttgttattaatgctggc
ggcgggatacacggacatccaaatggagcgcaaggcggcggtaaagctttccgtactgca
attgatgctactttgcaaaataaaccactccatgaagtagacgacataaatttgcatagt
gcactacaaatatggggaaatccctcttatgaggtgaaattatga

DBGET integrated database retrieval system