KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4354Help
Entry
HD73_4354         CDS       T02460                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
btt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_4354
Enzymes [BR:btt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     HD73_4354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGE79932
Position
complement(4210222..4211364)
Genome map
AA seq 380 aa AA seqDB search
MKTQIVINAKIYTGQEIVENGFIRYAETIKEIGLMAQYVPQENETVFDATGKIVIPGMID
VHIHGGYDIDAMDANSDGLVTLGKEMLKEGVTTYFPTTMTQAPEAIEAALTAAKEAKEKG
AHFEYIHLEGPYVSKKRAGAQPLEHIVPANIEQFKQWQEASGNLIKLVTYAPEEEGALEF
EQYLAETGVVGTMGHTDAIDAQLKNRKITHATHLYNQMRGLHHREPGVVGHVLLNPDVMV
EVITDGIHIHPDMVKLAYKLKGPKKVSVITDAMRAKGLEDGLYELGGQPVHVKDGSARLE
DGTLAGSILKMDQAFRNVIEFTGCSIEDAVLMTSVNQAEEFGLNNKGALAVGKDADFVVM
NEDLHVYDTVRLGIHMKEGK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcaaattgtcatcaatgccaaaatttacacaggtcaagaaatagtggaaaac
ggatttattcgttacgcagaaaccattaaagaaattggtttgatggctcaatatgtacca
caagaaaatgaaactgtttttgatgctacagggaagattgtaattccaggtatgatcgat
gttcatattcatggtggatacgatattgatgcgatggatgcaaatagcgatgggttagta
actctaggtaaagaaatgttaaaagaaggggttacaacttacttcccaacaacaatgaca
caagctccagaggcaattgaagcagcgttaactgctgcaaaagaagcaaaagaaaaagga
gcgcattttgaatatattcacttagaaggaccttatgtttcaaagaaacgtgcaggtgca
caaccacttgaacatatcgttcctgcaaatattgagcaatttaaacaatggcaagaagca
agtgggaatttaattaaattagtaacatatgcaccagaagaagagggagcattagagttt
gaacaatatcttgctgaaactggtgtagttggcacaatggggcatacagatgcaattgat
gcgcaactaaaaaatagaaagattacacatgcgacacatttatacaatcaaatgcgtgga
ttacatcaccgtgaaccaggagttgttggtcatgtgttattaaatccagatgtaatggtt
gaagtaattacagatggcattcatattcaccctgatatggtgaaattagcatataagtta
aaaggaccaaaaaaagtaagtgttattactgacgcaatgcgtgcaaaaggtcttgaagat
ggattatatgagcttggcggacagccagtacatgtaaaagatggtagtgctcgattagaa
gatggaacgttagctggtagtattttaaaaatggatcaagctttccgaaatgtaattgaa
tttacaggttgttcaatcgaagatgcagtactgatgacatcagttaaccaagcagaagag
tttggattaaataataaaggtgcattagcggtaggaaaagatgcagactttgttgtgatg
aatgaagatttacatgtatatgatacggttcgtttaggaattcatatgaaggaagggaag
taa

DBGET integrated database retrieval system