KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4381Help
Entry
HD73_4381         CDS       T02460                                 

Definition
(GenBank) Transcriptional regulator, MarR
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 TrmB HTH_34 Penicillinase_R HxlR DUF1495 TxDE GntR Rrf2 HTH_45 PadR HTH_24 DUF2250 LexA_DNA_bind HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AGE79959
Position
complement(4231278..4231730)
Genome map
AA seq 150 aa AA seqDB search
MCKYDKKGTRLLNEKRETLILDLSASFRKMIRLLQNDINTRFAEHMPYNEFSVLRALFLK
SPQMASQIASEVNVTSSHITAVTDRLVRKGLVERKRSNSDRRIVYLEITEHGREVTEKLE
AVRKEYYKERFKGWSDQEIEMVLELFGRVL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaatatgataaaaaagggacgaggctattgaacgaaaaaagagaaacgctgatt
ttagatttatctgcatcatttcgaaaaatgatacgtttattacaaaatgatattaataca
cgttttgcagaacatatgccatataatgaattttctgtattacgtgcgttatttttaaag
agtccacagatggcttcgcaaattgcgagtgaagtaaacgtaacctccagtcatattaca
gctgttacagatcgtctcgtacgaaaaggattagtagaaagaaaacgttctaattcagat
cgtcgaatcgtgtatttagaaattacagagcacggaagagaagtaactgaaaaacttgaa
gctgtgcgtaaagaatattataaagagagatttaaaggttggagcgaccaagaaatagaa
atggtcttagaactatttggccgcgtattataa

DBGET integrated database retrieval system