KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4384Help
Entry
HD73_4384         CDS       T02460                                 

Definition
(GenBank) Divalent cation transport protein
  KO
K03284  magnesium transporter
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Brite
KEGG Orthology (KO) [BR:btt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btt02000]
    HD73_4384
Transporters [BR:btt02000]
 Other transporters
  Pores ion channels [TC:1]
   HD73_4384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorA
Motif
Other DBs
NCBI-ProteinID: AGE79962
Position
complement(4233935..4234933)
Genome map
AA seq 332 aa AA seqDB search
MIRICAVTKTDEVLYDVSLEETKKDHIVWYWLDLYKPTKEEYTYILQDHFKFHPLAIEDC
IEYVQRPKVDFYDGYNFLVLHAFGEDGLEPHEIDLFISDRYIVSFHFSHNNAIERVWKTL
GEKKRIKNSPLHVAHTIIDQIVDDYFAPVYYIEDHLNAIDDNLTGETAGSVLEEVFDIRT
DLSKLRRTIIPMRDLLYRILNSTRFYGISDHEIYFKDIHDHLLKLTEMIEASRELTADIR
DSYFSLNSHHMNNIMKTLTVFSTIFMPLTFIAGVYGMNFTHMPELGGQYSYFICLLIMAL
IGGGMMAWFYKKDGLSKKTPRISSVFFLTNSM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattagaatttgtgcagtaacaaaaacagatgaagtattatatgatgtttctctagaa
gaaacaaagaaagaccatattgtatggtattggctagatttatataagccaacgaaagaa
gagtatacatatattctgcaagaccattttaagttccatccccttgcaattgaagactgt
atagaatatgtacagaggccaaaagttgatttttatgatggatataactttttagtactt
cacgcatttggggaagatggactagaaccgcacgaaatcgatttatttattagtgatcgt
tatattgtttctttccacttttctcataacaatgcaatcgaaagagtatggaaaacactt
ggagaaaagaagcgtattaaaaatagtcctttacacgtagctcatacaattatcgaccaa
attgtagatgactattttgcgcctgtatattacattgaggatcatttaaatgcaattgat
gataatttaacgggggagacagcaggaagtgtattagaagaggtatttgatatacgtaca
gatttatcaaagctaaggcgtacaatcattccgatgcgtgatttattatatcgtatttta
aattcgactcgtttttacggtataagcgatcatgaaatttactttaaagatatacatgat
catttgcttaaactaacagaaatgattgaggcaagccgagagttaacagcagatattcgg
gatagttatttttcattaaactcacatcatatgaataacattatgaaaacattaactgta
ttctcgactattttcatgccattaacatttattgcgggagtatatggaatgaactttacg
catatgccagagcttggtggacaatatagttattttatttgtctacttattatggcacta
attggcggcggaatgatggcctggttttataaaaaggatggtttaagtaaaaaaacaccg
aggatttcctcggtgttttttttaaccaatagcatgtaa

DBGET integrated database retrieval system