KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4394Help
Entry
HD73_4394         CDS       T02460                                 

Definition
(GenBank) Acetyltransferase, GNAT
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4 Acetyltransf_8
Motif
Other DBs
NCBI-ProteinID: AGE79972
Position
4242148..4242699
Genome map
AA seq 183 aa AA seqDB search
MKPLLLDFPTLFQTERLQVRKPFPGDGAEVYEAIQASLEDLVPWIPINAETEESAEEIVR
EAHGQFLLRETLDFHLYDKVSGTFIGAITLQPENWDIPKFSLHFWLHSAYTKQGYMTEAV
KGAIQFAFDKLGARRIEIRTDATNINACSLAERLEFILEGTMENDFLAPDGSLRDARVYA
KIN
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccattattattagattttccaacattatttcaaactgaacgcttgcaagttcgt
aaaccatttccaggtgatggtgcagaagtatatgaagcaatccaagcttctctagaagac
ttagtaccgtggataccaattaacgctgaaacagaagagagtgctgaagaaattgttcgc
gaagctcacggacagtttttacttcgtgaaacacttgattttcacttatacgataaagta
tctggtacattcatcggagcaattacactacagcctgaaaactgggatattccaaagttt
tcacttcacttctggctacatagtgcctatacaaaacaaggctatatgaccgaagctgtt
aaaggtgcaattcagttcgcctttgataaactaggcgctagaagaattgaaattcgtact
gatgcaacaaatataaatgcatgtagcttagcagaacgtctagaattcattctagaaggt
acaatggaaaatgatttcctagcaccagatggtagcttacgtgatgcacgtgtatatgca
aaaatcaattaa

DBGET integrated database retrieval system