KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4567Help
Entry
HD73_4567         CDS       T02460                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00010  Glycolysis / Gluconeogenesis
btt00052  Galactose metabolism
btt00500  Starch and sucrose metabolism
btt00520  Amino sugar and nucleotide sugar metabolism
btt00521  Streptomycin biosynthesis
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01120  Microbial metabolism in diverse environments
btt01130  Biosynthesis of antibiotics
btt01200  Carbon metabolism
Module
btt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HD73_4567
   00052 Galactose metabolism
    HD73_4567
   00500 Starch and sucrose metabolism
    HD73_4567
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_4567
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HD73_4567
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HD73_4567
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HD73_4567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AGE80145
Position
complement(4386996..4387979)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTGEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETNKESMLRSMLAEEGRITSKDVFEALGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtacggtgaaattttacataagtgggaaatccctacgaatacaggtgagcaa
ggaaaacatattacacttgatgttgcgaaagcaattgataaaaagctagaagaattaggc
gaattgaagagcaagttaattggtattggtatgggagctcctggtcctgtacatgtggcg
tctggaatgatttatgaagcggttaatttaggatggaaaaactatccgctaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggtgcaaaagatttaatctgtatgacacttggt
acgggcgttggtggtggtgtaatcgccaatggtgagattgtacacggcgtgagtggtgct
gctggtgagattggacatattacagtcgttacagaaaatgctttcccatgtaattgcggg
aagtctggttgcttagaaacagtagcatctgcgacaggtattgtacgtgttgctatgcaa
aaaatacaagagactaataaagagagcatgttgcgttctatgttagctgaagaaggacgt
attacatcaaaagatgtctttgaagcacttggacaaggtgatgaattagcaggtgaagta
gtagaaaaagtagcctcttatttaggattagctgtagcgaacctttctagtacattgaac
ccagagaaaattgttattggtggaggcgtgtctaaagctggagatgcgctattagaacca
attcaacgctatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system