KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4572Help
Entry
HD73_4572         CDS       T02460                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00051  Fructose and mannose metabolism
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HD73_4572
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_4572
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     HD73_4572
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     HD73_4572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Fucokinase DUF4954 Hexapep_2 YbaJ
Motif
Other DBs
NCBI-ProteinID: AGE80150
Position
complement(4390322..4391560)
Genome map
AA seq 412 aa AA seqDB search
MKGVILAGGKGRRLRPLTCNTPKPMLPLLEKPVLEYNIELLRQHGIREIAITVQYMSTTI
KQYFGDGSKWGVNLYYFEDSPPLGTAGSIKQAEQFLDETFVVISGDALTDFQLSEGIRFH
EQKKRMVTMFVKEVENPLSFGLVVMNKNQEVTRYIEKPGWNEVVSNVVNTGIYIMEPEIF
SYIPPRQFFDFSHDVFPLLANKNLLFAYLSEGYWLDIGTFNQYRQAQFDLLTKKLQVPIP
YTEVLPMVWMGEGVTIGKGTKIHGPSFIGEGAKIGTGAVIEPYSIIGKNSIVSSYSHLQK
SIVFANAHIGKYCELLETTIGERTIVEDDVTLFQKSVVADHCHIGRSTVIKQKGKLWPYK
AIDSHSIVGAAGIQESEMSAGWLQKSRIVGRGNVEITPQFIVKIAMAYGSLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggttattttagctggaggaaaaggaagacgccttagaccattaacatgcaat
actccaaagccgatgttaccattattagaaaaaccagttttagaatataatattgagtta
ttacgtcagcatggtattcgtgaaattgcaattactgttcaatatatgagtacgaccatt
aagcaatattttggtgacggtagtaaatggggagttaacttgtattattttgaagactct
cctccgcttggcacagcagggagtattaaacaagcagaacaatttttagatgaaacattt
gttgtgataagcggggatgcattaactgactttcaattatcagaaggaattaggtttcat
gaacaaaagaaaagaatggtaacaatgtttgtgaaagaagtagaaaatccactctcattt
ggattggttgtaatgaataaaaaccaggaggttacacgatatatagaaaagccgggctgg
aatgaggtagtatctaatgttgtgaatacaggcatatatattatggagccagaaatcttt
tcttacataccgcctaggcaattttttgatttcagtcatgatgtgtttccattattggca
aacaaaaatttgttattcgcatatttgtcagaaggttattggttagatatcggcacattt
aatcaatatcgacaagcacaatttgatttgttaacgaaaaagttacaagtacctattcct
tatacagaagtattacctatggtatggatgggggaaggggtgacgattggtaaagggacg
aaaattcatggcccctcttttattggagaaggagcaaagattggtacaggagctgtaatt
gagccatattctattattgggaaaaatagtatcgtttcaagttattctcatcttcaaaaa
agtattgtttttgcgaatgcccacattgggaagtattgtgaactattagaaacgacaata
ggagagcgtacaatagttgaagatgatgttacactgtttcaaaaaagtgttgtagcggat
cactgtcatatcgggagaagtacggtaattaagcaaaaaggaaaactatggccttataag
gcgattgatagtcattcgatagtaggagcggctggtattcaagagagtgaaatgagtgca
gggtggttacaaaaaagccgcattgtaggaagagggaatgttgaaattactccccagttt
atcgtgaagattgcgatggcgtatggttctcttttttga

DBGET integrated database retrieval system