KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4665Help
Entry
HD73_4665         CDS       T02460                                 

Definition
(GenBank) Phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00360  Phenylalanine metabolism
btt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btt00790  Folate biosynthesis
btt01100  Metabolic pathways
btt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    HD73_4665
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HD73_4665
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HD73_4665
Enzymes [BR:btt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     HD73_4665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AGE80243
Position
4474469..4476223
Genome map
AA seq 584 aa AA seqDB search
MTKKTEIPSHLKPFVSTQHYDQYTPVNHAVWRYIMRQNHSFLKDVAHPAYVNGLQSSGIN
IDAIPKVEEMNECLAPSGWGAVTIDGLIPGVAFFDFQGHGLLPIATDIRKVENIEYTPAP
DIVHEAAGHAPILLDPTYAKYVKRFGQIGAKAFSTKEEHDAFEAVRTLTIVKESPTSTPD
EVKAAENAVIEKQNLVSGLSEAEQISRLFWWTVEYGLIGNIDDPKIYGAGLLSSVGESKH
CLTDAVEKVPFSIEACTGTTYDVTKMQPQLFVCESFEELTDALETFSKTMAFKTGGKEGL
EKAIRSENYATAELNSGLQITGTFSETIENDAGELIYMRTNSPTALALHNKQLANHSTSV
HSDGFGTPIGLLTENIALENCTDEQLQSLGIKIGTIAEFTFASGIHVKGTVTDIVKNDKK
IALISFIDCTVTYNARVLFDASWGAFDMAVGSQITSVFPGAADAAAFFPMDEEVQEIPAP
LVLNELERMYQTVRDIRSEGILHDAHIDQLVAIQEVLNKFYAKEWLLRLEVLELLLEHNK
GHETSAALLHQLSTFTTDEAVTRLINNGLALLPIKDVKNDAKIN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaacagaaattccatcgcatttaaaaccatttgtatccacacaacattat
gatcaatacacaccggtgaatcacgctgtgtggcgttacattatgagacaaaatcatagc
ttcttaaaagacgttgctcatccagcctatgtgaacggactacaatcatctggtattaat
atagatgcaattccaaaagtagaagaaatgaatgagtgtttggcaccaagcggctggggc
gctgtaacaattgacggacttattcctggcgtagcattcttcgattttcaaggacacgga
ttactaccgattgcaacagatatccggaaagtagaaaatatcgagtacacaccagctcca
gatatcgtacatgaagccgcaggacacgcaccgattttacttgatcctacatatgcaaaa
tatgtgaaacgttttgggcaaattggtgcaaaagctttctctacaaaagaagaacatgat
gcatttgaagctgttcgtacattaacgatagtaaaagaaagccctacttctactcctgat
gaagttaaggctgctgaaaatgctgtaattgaaaaacaaaacttagtttctggtttatcg
gaagctgaacaaatttcacgtcttttctggtggacagtagaatatggattgatcggaaat
atagatgatccaaagatatatggtgctggtctcctttcttctgttggcgaaagcaaacat
tgcttaacagacgctgtagaaaaggttccattttctatcgaagcatgtacagggacaact
tatgacgtaacaaaaatgcaaccacaactatttgtttgtgaatcctttgaagaattaaca
gatgcgcttgaaacattttctaaaacgatggcctttaaaacaggtggaaaagaaggttta
gaaaaagcaattcgctctgagaactatgcaacagctgagctaaatagtggattacaaatc
acaggtacatttagcgagacaattgaaaacgatgcaggtgaattaatttacatgcgaaca
aattcgccaacggcattagcgcttcataataaacagttagcgaatcattctacttctgta
cacagtgacggatttggaacaccgattggattacttactgaaaatattgcattagaaaat
tgtacagacgaacaactacaatcattaggaattaaaattggaactatcgctgagtttact
tttgcaagtggtattcatgtaaaaggaacagtaacagatattgtgaaaaatgataagaaa
attgctcttatttcctttatcgattgcacagttacttataacgcccgcgttttatttgat
gcttcatggggcgcatttgatatggctgttggctcacaaatcacttcagtattcccaggt
gccgcagatgcagcagcatttttcccaatggatgaagaagttcaagaaattcctgctccg
cttgtactgaatgaactcgagcgtatgtatcaaacagttcgagatattcgaagtgagggg
attttacacgacgcgcatatcgatcaattagtagcaattcaagaagtattaaataaattt
tatgcgaaagaatggttgctgcgccttgaagtattagagttacttttagagcataacaaa
gggcatgaaacatctgcagcattactacatcaactttctactttcacaactgacgaagct
gtaacacgccttattaacaatggtcttgcgttacttccaataaaggatgtgaaaaatgat
gctaagattaactga

DBGET integrated database retrieval system