KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4768Help
Entry
HD73_4768         CDS       T02460                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00860  Porphyrin and chlorophyll metabolism
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HD73_4768
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btt01007]
    HD73_4768
Enzymes [BR:btt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HD73_4768
Amino acid related enzymes [BR:btt01007]
 Aminotransferase (transaminase)
  Class III
   HD73_4768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGE80346
Position
complement(4576450..4577739)
Genome map
AA seq 429 aa AA seqDB search
MKKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVL
SWGPLIHGHANDRVVEALKSVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTE
ATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTI
TVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFD
EVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGT
LSGNPLAMAAGYETLVQLTPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIF
FTDEPVINYDAAKSSNLEFFAAYYREMVEQGVFLPPSQFEGLFLSTAHSDADIEATIAAA
EIAMSKLKA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttgataagtcaattgcagcgtttgaagaggcgcaagacttaatgcctggt
ggcgtaaatagcccggttcgtgcctttaagtctgttgggatgaatccgttgtttatggag
cgtggaaaaggctctaaagtatatgatatcgatgggaatgaatacatcgactacgtatta
tcatggggtcctttaattcatggtcatgcaaatgatcgtgttgtagaagcgttaaaatct
gttgctgaaagaggtacaagcttcggtgcaccaacagaaattgaaaataaattagcaaaa
cttgttattgagcgcgtgccatcaattgagattgtgcgtatggttaactctggaacggaa
gcaacaatgagtgcactacgtttagctcgtggttatacaggtcgtaataaaatcttgaaa
tttatcggttgttaccacggtcatggtgattcgttattaattaaagctggttctggtgtg
gcgactttaggtttaccagatagtcctggtgtaccagaaggtgtagcgaaaaatacgatt
acagtagcttataacgatttagaaagtgtaaaatacgcgtttgaacaattcggtgatgat
attgcttgtgtaattgtagaaccagtagcaggaaatatgggggttgttcctccgcagcct
ggatttttagaaggtcttcgtgaagtaacagaacaaaacggtgcattgcttatttttgat
gaagtaatgacagggttccgagtagcttataattgtggccaaggttattatggcgtaacg
cctgatttaacatgcttaggtaaagtaatcggtggtggtttaccagtaggagcatacggt
ggtaaagcggaaattatgcgccaagttgcgccaagcggaccgatttaccaagctggtact
ttatcaggtaacccacttgcaatggcggcaggttatgaaacgttagtacagttaacgcca
gaatcatatgtagaatttgagcgtaaagctgaaatgttagaagctggattacgtaaagca
gctgaaaaacatggcattcctcaccatattaaccgtgcaggctctatgattggtattttc
tttacagatgaacccgttattaattacgatgcagcaaaatcttcaaacttagaattcttt
gcggcttactatcgtgaaatggtagaacaaggtgtattcttaccgccatctcaattcgaa
ggtttattcttatcgacagcacatagtgatgcagatattgaagcgacgattgcagcagct
gaaattgcaatgtcaaaattaaaagcgtaa

DBGET integrated database retrieval system