KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_5401Help
Entry
HD73_5401         CDS       T02460                                 

Definition
(GenBank) Methionyl-tRNA synthetase 2
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00450  Selenocompound metabolism
btt00970  Aminoacyl-tRNA biosynthesis
btt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HD73_5401
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HD73_5401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btt01007]
    HD73_5401
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:btt03016]
    HD73_5401
Enzymes [BR:btt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HD73_5401
Amino acid related enzymes [BR:btt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HD73_5401
Transfer RNA biogenesis [BR:btt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HD73_5401
 Prokaryotic type
   Other AARSs
    HD73_5401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AGE80978
Position
complement(5152912..5154546)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKEIADKYHEEFQRCFRSLGFTYDCYTRTDSEHHHETVQNVFLRLLEEGHIYKKTV
EQAYCETCTQFLPDRYVEGICPHCHEAARGDQCDACSAILDPLDLLEKKCKLCGSTPSVE
ETEHFYFALHTFQQQIKRAVEIAKQTGTWRDNAIQLTERYVKEGLIDRAVSRDLPIGVPI
PVEGYEDKKIYVWIEAVTGYYSASKHWAEETGKDDQEFWDSEAKTYYVHGKDNIPFHSVI
WPAVLLGIGEEAIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYDPDSIRYFLTVNA
PENRDTDFSWREFIYSHNSELLGAYGNFVNRTLKFIEKYYGGIVTKGSIEVELKDKVEGL
YKRVGEAIEQTKFKVALETIFDTVRFANKYFDEKQPWKQREDDPVSCEETIYNCVYLIAN
FAHLLEPFLPFSSERVRNTLSIVNRNWEPQNTLPSRIDSVQPLFERIDVKQIEHEIEKLY
GAVK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattggaggcgcttggccgtatgcaaatggttcgttacaccttggccat
attgcgagtttgttacctggagatattttagcgcgttattacagggcaaaaggtgagaat
gtgctgtatgtttcagggagtgattgtaatggaacaccgattgcaattagagcaaaacaa
gaaggtgtgacagcgaaagaaattgctgataagtatcatgaagagttccagcgatgtttt
cgtagccttggttttacttatgattgttatacacgtacagatagtgagcaccatcatgaa
acggttcaaaatgtttttttacgtttattagaagaaggacatatttataaaaaaacagtg
gaacaagcgtattgtgaaacgtgtacacagtttttaccggatcgttatgtagaaggaata
tgtccacattgccatgaagcagcaagaggagatcaatgcgatgcttgttctgctatttta
gatcctctcgatttgttagaaaagaaatgtaagttatgtggtagtacgccatctgtagag
gaaacagagcatttctattttgcattgcatacatttcagcagcaaattaaaagagctgta
gaaattgccaaacaaacagggacatggcgcgacaatgcgattcaactaacagagagatat
gtaaaggaaggattaatagatagggccgtatcacgtgatttaccaattggggtaccaatt
ccagtagaagggtatgaagataagaaaatttacgtatggattgaagcagtgacaggctat
tattcagcgagtaaacattgggctgaagaaacagggaaagatgatcaagagttttgggat
agcgaagcgaaaacatattatgtgcacggaaaggataatattccgtttcattccgtcatt
tggccagcggtattacttggaataggggaggaagcaatcccgcgtcatatcgtttcgaat
gaatatttaacagttgaaaaaagaaaattatctacaagtaaaaactgggcagtatgggtg
cctgacatattagaacgctatgatccagattctattcgttactttttaaccgtcaacgca
ccagaaaatcgcgatactgatttttcatggcgggaatttatttacagtcataatagtgaa
ttattaggtgcatacgggaactttgtgaaccggacattaaagtttatcgaaaaatattat
ggtggtatcgtgacgaagggaagtattgaggtagagctgaaagataaagtagaaggatta
tataagcgtgtaggagaggcgattgagcaaactaaatttaaggtggcgctagaaacaata
tttgatacagtacgttttgcaaataaatattttgatgaaaagcagccttggaaacaaaga
gaagatgatccagtttcatgtgaagaaacgatttataactgtgtgtatcttatcgctaat
tttgcccatctccttgaaccatttttaccattttcaagtgaaagagttcgaaacacattg
tcgattgtgaaccgaaattgggaaccgcaaaatacgttgccaagtagaattgatagcgta
cagccattatttgagcgaatcgatgtaaaacaaattgagcatgagatagagaagctgtat
ggagcggtaaaatga

DBGET integrated database retrieval system