KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_5604Help
Entry
HD73_5604         CDS       T02460                                 

Definition
(GenBank) UDP-glucose 6-dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00040  Pentose and glucuronate interconversions
btt00053  Ascorbate and aldarate metabolism
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HD73_5604
   00053 Ascorbate and aldarate metabolism
    HD73_5604
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_5604
Enzymes [BR:btt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     HD73_5604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C ApbA NAD_Gly3P_dh_N F420_oxidored NAD_binding_8 NAD_binding_2 Pyr_redox 3HCDH_N AlaDh_PNT_C Pyr_redox_2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGE81181
Position
complement(5332900..5334225)
Genome map
AA seq 441 aa AA seqDB search
MKITIVGTGYVGLITGVGLAKLGHSVTCFDIDDEKIERIKQGDLPIYEARLHELINYAYE
NNALTFTSNKEEAFDDVEFIFIAVGTPPLLDGTADLTYIQSACNDIGLYATNDIIVVTKS
TVPVGTNDVMKGWIEEKLKGRHTVHIVSNPEFLREGSGIYDFFHGDRIVIGADSEEVARR
VESLYSELCLETYVTDIKSAEMIKYASNAFLATKISFINEISNICEKVGANVLDVAKGMG
MDKRIGASFLNAGIGYGGSCFPKDTKALVQIAGNVAHDFRLLKAVIEVNNKQQLLLIEKA
KKVMNMNKKRIAVLGASFKPNTDDIREASSLIIIEALINIGADIVLYDPKAIQYVKNIFG
DAIQYSRCIDESIRDASAVFIVTEWGDIQTYPLEKYVQLMREPILFDGRNCYTDEDVKKQ
KIDYYSVGRKSICNRKVSVMR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacgatagtaggtactggatatgttggattgattacaggagtaggattggca
aaattagggcattcagttacatgttttgatatagatgatgaaaaaattgaacggataaaa
caaggggatttacctatttatgaggccagattacatgaattaataaattatgcatatgag
aataatgctttaacttttacatcaaataaagaagaggcatttgatgatgtagagtttata
tttattgcagttggaacaccacctttattagatgggacggcagatttaacgtatattcag
agtgcttgtaacgatattggattatatgcgacgaacgatattattgttgttacgaaaagt
acagttccagtaggtacaaatgatgtaatgaagggatggattgaggagaagttaaaaggg
aggcatacagtacatatcgtatcgaatccagagtttttgcgtgaaggttcaggtatttat
gatttctttcatggagatcgtattgtaattggagcggatagtgaggaagtagcaagaaga
gtagagagtttgtatagtgaattatgtttagaaacgtatgttacagatattaaaagtgcg
gagatgattaaatacgcgtcgaatgcctttttagctacaaagattagtttcattaatgaa
atttcaaatatatgtgagaaggtaggcgcgaatgtattggatgttgccaaagggatggga
atggataagagaatcggtgcatcttttttaaatgcgggcattggctacggagggtcgtgt
tttccgaaagatacgaaagcactggtacaaattgcgggaaatgttgctcatgattttcgt
ttgttaaaagcagttattgaagtaaataataagcaacagctgctattgattgaaaaagcg
aaaaaagttatgaacatgaataaaaagcggattgcagttcttggcgcatcctttaaaccg
aatacggatgatattagagaggcatcatctcttattataatagaagcattaattaatata
ggtgcagatattgttctttatgacccaaaagcaattcaatatgtaaagaatatatttgga
gatgctatacaatatagtagatgtatagatgaatcgattagagatgcgagtgcggttttt
atcgtaacagaatggggagatattcaaacgtatccgttagaaaagtacgtacaacttatg
agggagcctattttatttgatgggagaaattgttatactgatgaagatgttaagaaacaa
aagatagattattactcggtgggaagaaaaagtatttgtaatagaaaagtttctgttatg
cgttaa

DBGET integrated database retrieval system