KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_5669Help
Entry
HD73_5669         CDS       T02460                                 

Definition
(GenBank) UDP-glucose 4-epimerase / UDP-N-acetylglucosamine 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00052  Galactose metabolism
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HD73_5669
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_5669
Enzymes [BR:btt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     HD73_5669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR NAD_binding_10 NAD_binding_4 NmrA UDPG_MGDP_dh_N TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGE81246
Position
complement(5404359..5405381)
Genome map
AA seq 340 aa AA seqDB search
MAVLVTGGAGYIGSHTCVELLNSGYEVIVVDNLSNSSVESINRVKEITGKQFKFYKEDVL
NREALDAIFEENSIEAVIHFAGFKAVGESVAIPLTYYHNNITSTLVLCEVMQKHNVKKII
FSSSATVYGIPETSPITEEFPLSATNPYGQTKLMIEQIMRDVAFADAEWSIALLRYFNPF
GAHESGRIGEDPNGIPNNLMPYVTQVAVGKLKELSVFGNDYPTKDGTGVRDYIHVVDLAN
GHVKALEKVLSTTGVDAYNLGTGMGYSVLEMVEAFEKVSGKKVPYKITERRPGDVAVCFA
DASKAKRELGWEATRGLEEMCADSWRWQSENKTGYQKVSN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcagtacttgtaacaggtggagcaggatatattggtagtcatacatgtgtagaatta
ctaaatagcggttacgaagttatagtagtggataatctttcgaatagctcggtagaatct
ataaatcgagtaaaagaaataacaggaaaacaatttaagttttataaagaagatgtttta
aatcgcgaagcgcttgacgcaatttttgaagaaaattcaattgaagcagttattcacttt
gcaggatttaaagctgtaggggagtcagtagcgattccattaacatattatcataacaac
attacaagcacgttagtgctatgtgaagtaatgcagaaacataatgtaaagaagataatc
tttagttcatctgcaactgtatatggtatcccggaaacgtcaccgattacggaggagttt
ccattaagtgcaacaaatccatatggtcaaacgaaattaatgattgagcaaattatgcgt
gatgtagcatttgcagatgcagaatggagtatcgcattacttcgctatttcaatccattt
ggtgcacacgaaagtgggcgtatcggagaagatccaaatggaatcccaaataacttaatg
ccatatgtaacgcaagtagcagtaggtaagttaaaagaattaagcgtattcggaaatgac
tatccaacgaaagatggaacaggagtccgtgattacatccatgttgtggacttagcaaat
ggtcacgtaaaggcgcttgagaaagtactgagtacaacaggagtagatgcttataacctg
ggcacaggtatgggctatagtgtactagagatggttgaagcatttgaaaaagtttcgggt
aagaaagttccttataaaattacagagcgtcgcccaggtgatgtggcagtatgttttgct
gatgcatcgaaagcaaagcgtgaattaggctgggaggcaacacgcggattagaagaaatg
tgtgcagattcttggaggtggcagtctgaaaataagactggatatcaaaaagttagtaac
tag

DBGET integrated database retrieval system