KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_5727Help
Entry
HD73_5727         CDS       T02460                                 

Definition
(GenBank) PTS system, glucose-specific IIA component
  KO
K02777  PTS system, sugar-specific IIA component [EC:2.7.1.-]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00010  Glycolysis / Gluconeogenesis
btt00500  Starch and sucrose metabolism
btt00520  Amino sugar and nucleotide sugar metabolism
btt01100  Metabolic pathways
btt02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:btt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HD73_5727
   00500 Starch and sucrose metabolism
    HD73_5727
   00520 Amino sugar and nucleotide sugar metabolism
    HD73_5727
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HD73_5727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btt02000]
    HD73_5727
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     HD73_5727
Transporters [BR:btt02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    HD73_5727
   Maltose/glucose-specific II component
    HD73_5727
   Maltose-specific II component
    HD73_5727
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component
    HD73_5727
   Trehalose-specific II component
    HD73_5727
   N-Acetylmuramic acid-specific II component
    HD73_5727
   Alpha-glucoside-specific II component
    HD73_5727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 Biotin_lipoyl_2 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AGE81304
Position
complement(5456796..5457293)
Genome map
AA seq 165 aa AA seqDB search
MFKKLFGLGSKTNEETIVAPLTGAVKNIEEVPDPVFAGRMMGDGVAIDPTEGVVVSPVDG
EIVQLFHTKHAIGIKAKNGTEILIHVGLETVKMEGEGFEAHVSEGQAVKAGDKLISFDLE
LIREKAKSTITPIVITNTDAAESIKTTVGVAATKGSTEVMKVTMK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaattattcggtcttggttcaaaaacaaatgaagaaacaatcgtagctcca
ttaactggagcagtgaaaaatattgaagaagtaccagatccagtatttgctggtcgtatg
atgggtgacggtgttgcaatcgatcctactgaaggtgtagttgtatctccagttgatggt
gaaatcgtacaattattccacacaaaacatgctatcggaattaaagcgaaaaacggtaca
gaaattttaatccacgttggattagaaactgtaaaaatggaaggcgaaggtttcgaagct
cacgtttctgaaggccaagctgtaaaagctggagataaattaatctcattcgacttagaa
ttaatccgtgaaaaagcgaaaagcacaattactccaattgttattacaaacacagatgca
gctgagtctattaagacaactgtaggcgtagcagctacaaaaggttcaacagaagtaatg
aaagttacaatgaaataa

DBGET integrated database retrieval system