KEGG   Borrelia turicatae: BT0482
Entry
BT0482            CDS       T00737                                 

Definition
(GenBank) SSU ribosomal protein S19P
  KO
K02965  small subunit ribosomal protein S19
Organism
btu  Borrelia turicatae
Pathway
btu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:btu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BT0482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:btu03011]
    BT0482
Ribosome [BR:btu03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    BT0482
  Archaea
    BT0482
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-ProteinID: AAX17810
UniProt: A1QZR8
Position
501721..501999
AA seq 92 aa
MARSIKKGPFIEKSLYQKVLASSGREKRVVIKTYSRASTIIPEMVSLTISVYNGKSFIPV
YITEDLVGHKLGEFSPTRIFRGHAKSDKKGRK
NT seq 279 nt   +upstreamnt  +downstreamnt
gtggcaagatctattaaaaaaggaccttttatagaaaagagtctttatcaaaaagtttta
gcctcttctggcagagagaaaagggtggtaattaaaacctattctagagcctcaacaata
attcctgagatggtaagtcttactatatctgtttacaatgggaagtcttttattcctgtg
tatattactgaagatcttgttgggcataagcttggggaattttcacctacaagaattttt
aggggacatgctaaatcagataagaagggaaggaagtag

DBGET integrated database retrieval system