KEGG   Borrelia turicatae: BT0632Help
Entry
BT0632            CDS       T00737                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btu  Borrelia turicatae
Pathway
btu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:btu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BT0632
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:btu03400]
    BT0632
Enzymes [BR:btu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BT0632
DNA repair and recombination proteins [BR:btu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BT0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 AAA_11 Viral_helicase1 UvrD_C_2 Helicase_RecD DUF2075 PhoH AAA_22 T2SSE RsgA_GTPase AAA_5 SH3_13 Zeta_toxin AAA_16 AAA DUF3825 AAA_28 TsaE Med26_C Flavi_DEAD RNA_helicase Cgr1 CobA_CobO_BtuR AAA_18
Motif
Other DBs
NCBI-ProteinID: AAX17950
UniProt: A1R058
Position
complement(667205..669031)
Genome map
AA seq 608 aa AA seqDB search
MRNFLVLREFLKDHKRNYLNPELKIYEIIETLNINIENYYKAHLLTKKIKDKKYEEITIF
LIFLFNYLSKGHLRANINLLIKDIQNTIDCAFLEIKDEDQSYQKSINILEELAKITQATK
IHEIILHLKENNIMKDLNQNERIITPLILENNIHIYTQKNFREEEELIKKIDQRLKDNKS
EITTQRIQNIMNNLNTKDLSEEQINSIKKSLKSNFFILSGGPGTGKTTTINYILKAIDMH
LNVKQKVALVAPTGKASQKLKSSLKESFTNLETEYSTVQKLLKMSFINKGNKYDEANPLE
FEIIIIDEASMIDLSTFLKLLKAVKRNTKLIITGDKNQLPSIAGGNVYSSLTQIKEISDE
NVEILKKNFRSNDEINLLAKAIYQEDTNLIDIQLNANKNIILKDINKVNIENELLNHTKD
LYKKISNFDLNSLNNKEIESIINALLSNVILCSRNFGKFGTKRINEIIKLYLKKTYGNLI
GQIILITQNDYKNDLFNGERGILFRENSKIYALFKREDEKYKRINFNLINKYELSFATTI
HKSQGSEYQHVQIIIEDHPFLTKELLYTAITRAKESIKIISSKDIIKNVSLKTIKRDSKI
SDHIDALK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattttttagtcttaagagagtttctaaaagatcataagagaaactatttaaat
ccagaactcaaaatttatgaaataatagaaactttaaacataaacatagaaaattactac
aaagcacatttactcacaaaaaaaatcaaagataaaaagtatgaagaaattactattttt
ttaatatttttatttaattacctctctaaaggacatttaagagctaatattaatttatta
atcaaagatattcaaaatacgatcgactgtgctttccttgaaataaaagacgaggatcaa
tcttaccaaaaatcaatcaatatactagaagaacttgcaaagattacacaagcaacaaaa
atacacgaaataatcttacatttaaaagaaaataatataatgaaagatcttaatcaaaat
gaaagaatcataactcctttaatattagaaaataatattcacatctatactcaaaaaaac
tttagagaagaagaagaactaataaaaaaaatagatcaaagacttaaagataacaaaagt
gaaataactacccaaagaatacaaaatataatgaacaacttaaacactaaagacctaagt
gaagaacaaatcaattcaatcaaaaaatctttaaaaagtaatttctttatactcagtggt
ggcccgggcacaggtaaaacaacaactatcaattatattctaaaagcaattgatatgcac
ttaaatgtcaaacaaaaggtagcccttgtagcaccaactggaaaagcaagtcaaaaacta
aaatcaagtctaaaagaatcatttacaaaccttgaaacagaatatagcacagtacaaaaa
ttattaaaaatgtcatttatcaataaaggcaataaatatgatgaagccaaccccctagaa
tttgaaataataataattgatgaagcatctatgatagatttaagtactttcttaaaatta
ttaaaggcggtcaaaagaaacacaaaactcataataacaggggacaaaaaccagcttcca
tcaatagctggaggaaatgtatattcaagtctgacacaaataaaagaaataagtgatgaa
aatgtagaaatacttaaaaaaaatttcagaagtaacgatgagataaatttattagccaaa
gcaatatatcaagaagacacaaatctaattgatattcaacttaatgccaacaaaaatata
attttaaaggatataaataaagtcaatatcgaaaatgaattattaaatcacacaaaagat
ttatataaaaaaatctctaattttgatctcaactcactaaacaacaaagaaattgaatca
ataattaatgctttgcttagcaacgtcattttatgctcaagaaattttggaaaatttgga
acaaaaagaataaatgaaataataaaattatatttgaaaaaaacctatggcaatttaatt
ggacaaataattttaattactcaaaatgattataaaaacgatctatttaatggagaaagg
ggtattctctttagagaaaactctaaaatttacgctttattcaaaagagaagatgaaaaa
tacaaaagaataaactttaatttaataaacaaatatgaacttagttttgcaacaacaata
cataaaagccaaggctctgaatatcaacatgtacaaataatcatagaagatcatccattc
ttaacaaaagaactactctacactgcaataacaagagctaaagaaagcataaaaataata
tcaagcaaagacatcatcaaaaatgtcagcctaaaaacaataaagagagattcaaaaatc
tcagatcatatagatgcattaaaataa

DBGET integrated database retrieval system