KEGG   Burkholderia thailandensis MSMB59: BTHA_2086Help
Entry
BTHA_2086         CDS       T03416                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00071  Fatty acid degradation
btv00072  Synthesis and degradation of ketone bodies
btv00280  Valine, leucine and isoleucine degradation
btv00310  Lysine degradation
btv00362  Benzoate degradation
btv00380  Tryptophan metabolism
btv00620  Pyruvate metabolism
btv00630  Glyoxylate and dicarboxylate metabolism
btv00640  Propanoate metabolism
btv00650  Butanoate metabolism
btv00900  Terpenoid backbone biosynthesis
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
btv01200  Carbon metabolism
btv01212  Fatty acid metabolism
btv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:btv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTHA_2086
   00630 Glyoxylate and dicarboxylate metabolism
    BTHA_2086
   00640 Propanoate metabolism
    BTHA_2086
   00650 Butanoate metabolism
    BTHA_2086
  Lipid metabolism
   00071 Fatty acid degradation
    BTHA_2086
   00072 Synthesis and degradation of ketone bodies
    BTHA_2086
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTHA_2086
   00310 Lysine degradation
    BTHA_2086
   00380 Tryptophan metabolism
    BTHA_2086
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTHA_2086
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTHA_2086
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTHA_2086
Enzymes [BR:btv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTHA_2086
Exosome [BR:btv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTHA_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIS95878
Position
1:2270161..2271342
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGVTAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRYGVTAESLASLKPAFAKDG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgaccgtgatccgcgcggtgctcgagcgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctcggccaggtgctgacggcgggc
tcgggccagaatccggcgcgtcaggcgctcatcgcggcggggctgccgaacgccgtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgctcgccgcgaac
gcgatcgtcgcgggcgacgcggagatcgtcgttgcgggcgggcaggagaacatgagcgcc
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagcttgtc
gacagcatgatcgtcgacggcctgtgggacgtctacaacaagtaccacatgggcgtcacg
gcggagaacgtcgcgaaggagtacgggatcacgcgcgaagcgcaggaccagttcgcggcg
ctgtcgcagaacaaggcggaagccgcgcagaaagccggccgtttcgacgacgagatcgtg
ccgatcgagatcccgcagcgaaagggcgagccgcttcgcttcgcgaccgacgagttcgtg
cgctacggcgtgacggccgagtcgctcgcgagcctgaagcccgcgttcgcgaaggacggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tctgcgaagaaggccgaggcgctcggtctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcatcgcgccgctgt
ctcgaacgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggtccacaagcagatgggctgggatacgtcgaaggtcaacgtg
aacggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgcaaaagcgcgatgcgaaacgcggcctcgcgtcgctttgcatc
ggcggcggaatgggcgtcgcgctcgcgctcgagcgcccgtaa

DBGET integrated database retrieval system