KEGG   Burkholderia thailandensis MSMB59: BTHA_3189Help
Entry
BTHA_3189         CDS       T03416                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00220  Arginine biosynthesis
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01130  Biosynthesis of antibiotics
btv01230  Biosynthesis of amino acids
Module
btv_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BTHA_3189 (argF)
Enzymes [BR:btv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BTHA_3189 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Toxin_31
Motif
Other DBs
NCBI-ProteinID: AIS96905
Structure
PDB: 

Position
1:3504858..3505787
Genome map
AA seq 309 aa AA seqDB search
MTAKTIRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTR
LSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAEN
SRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILDFK
LQLSTPPGYALDAKLVDAESAPFYQVFDDPNEACKGADLVTTDVWTSMGFEAENEARKRA
FADWCVDEEMMSHANSDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALME
FLLLGRLNH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaaaaccattcgtcactacctgcagttcaaggatttctcgctggaagactac
gagtacgtgctcgaacgcacgggtatcctgaagcgcaaattcaagaactacgagacctat
cacccgctgcacgaccgcacgctcgcgatgatcttcgagaagagctcgacgcgcacgcgc
ctgtcgttcgaggccgggatctttcagctaggcggccacgccgtgttcatgagcacgcgc
gacacgcagctcggccgcggcgaacccgtcgaggattcggcgcaggtgatctcgcggatg
gtcgacatcatcatgatccgcacgttcgagcaggacatcatccagcgcttcgccgaaaat
tcgcgcgtaccggtgatcaatggcctgacgaacgagtaccacccgtgccaggtgctcgcc
gacatcttcacgtattacgagcaccgcggcccgattcgcggcaagacggtcgcctgggtc
ggcgacgcgaacaacatgctgtacacgtggatccaggccgcgcgcatcctcgacttcaag
ctgcagctgtcgacgccgcccggctatgcgctcgacgcgaagctcgtcgatgccgaaagc
gcgccgttctaccaggtgttcgacgatccgaacgaagcgtgcaagggtgcggatctcgtc
acgaccgacgtgtggacgagcatgggcttcgaggcggagaacgaggcgcgcaagcgggcg
ttcgccgactggtgcgtcgacgaggaaatgatgtcgcacgcgaattccgacgcgctcttc
atgcactgcctgcccgcgcatcgcggcgaggaagtaacggcgggcgtgatcgacggcccg
caaagcgtcgtgtgggacgaggcggaaaaccgtctgcacgtgcagaaggcgctcatggag
ttcctgttgctcgggcgcctgaaccactga

DBGET integrated database retrieval system