KEGG   Burkholderia thailandensis MSMB59: BTHA_3570Help
Entry
BTHA_3570         CDS       T03416                                 

Definition
(GenBank) NHL repeat family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00053  Ascorbate and aldarate metabolism
btv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BTHA_3570
Enzymes [BR:btv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BTHA_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL NHL PD40 Phytase-like Str_synth
Motif
Other DBs
NCBI-ProteinID: AIS97641
Position
2:25571..26503
Genome map
AA seq 310 aa AA seqDB search
MESSNRPARTGAASAATLRVDCRNALGEGATWCDATRALYWVDIEGARLWRWRAAGAQGG
AATDSWEMPERIGCFALTDDPDVLLVGLASRLAFFDARRRAFTPIVDVEPDLPTRLNDGR
CDRAGAFVFGMKDEGGGSPRAVGGYYRLNPDLSLQRLALPLAAIANGIAFSPDGSAMYFC
DSPTREIQVCDYRPGGDVDRIRSFVRLADDCGEPDGSAVDADGGVWNAQWGGARIVRYDA
QGVETERIAVPTPQPSCVALDDGGRLYVTSARVGLDDGALARSPGAGGVFVADTRHAGLA
TSRFALARNA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcgaatcggccggcgcgaaccggtgcggcatccgccgcgacgctgcgggtc
gactgccgcaacgcgctgggcgagggcgcgacgtggtgcgacgcgacgcgcgcgctgtat
tgggtcgacatcgaaggcgcgcgcctgtggcgatggcgcgcggccggcgcgcaaggcggc
gcggcgacggacagttgggagatgcccgagcgcatcggatgcttcgcgctcaccgacgat
ccggacgtgctgctcgtcggcctcgcgtcgcgccttgcgttcttcgacgcgcgccggcgc
gcgttcacgccgatcgtcgacgtcgagcccgatctgccgacacggctgaacgacggccgc
tgcgaccgcgcgggcgcgttcgtgttcgggatgaaggacgagggcggcggctcgccgcgc
gcggtgggcggctattaccggctgaacccggatttgagcctgcagcggcttgcgctgccg
ctcgcggcgatcgcgaacggcatcgcgttttctccggacggctcggcgatgtacttctgc
gattcgccgacgcgggaaatccaggtgtgcgactaccggccgggcggcgacgtcgatcgc
atccggtcgttcgtgcggctcgccgacgattgcggcgagcccgacggctcggccgtcgat
gccgacggcggcgtgtggaacgcgcagtggggcggtgcgcggatcgtgcgctatgacgcg
caaggcgtcgagaccgagcgcatcgcggtgccgacgccgcagccgagctgcgtggcgctc
gacgacggcgggcggctgtatgtgacgagcgcgcgcgtcggtctagacgacggcgcgctc
gcgcgcagtccgggcgcgggcggcgtgttcgtcgccgatacgcgccatgcggggctcgcg
acatcgcggttcgcgctcgcgcgcaacgcgtga

DBGET integrated database retrieval system