KEGG   Burkholderia thailandensis MSMB59: BTHA_4199Help
Entry
BTHA_4199         CDS       T03416                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00010  Glycolysis / Gluconeogenesis
btv00053  Ascorbate and aldarate metabolism
btv00071  Fatty acid degradation
btv00280  Valine, leucine and isoleucine degradation
btv00310  Lysine degradation
btv00330  Arginine and proline metabolism
btv00340  Histidine metabolism
btv00380  Tryptophan metabolism
btv00410  beta-Alanine metabolism
btv00561  Glycerolipid metabolism
btv00620  Pyruvate metabolism
btv00625  Chloroalkane and chloroalkene degradation
btv00903  Limonene and pinene degradation
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTHA_4199
   00053 Ascorbate and aldarate metabolism
    BTHA_4199
   00620 Pyruvate metabolism
    BTHA_4199
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTHA_4199
   00561 Glycerolipid metabolism
    BTHA_4199
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTHA_4199
   00310 Lysine degradation
    BTHA_4199
   00330 Arginine and proline metabolism
    BTHA_4199
   00340 Histidine metabolism
    BTHA_4199
   00380 Tryptophan metabolism
    BTHA_4199
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTHA_4199
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTHA_4199
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTHA_4199
Enzymes [BR:btv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BTHA_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIS97933
Position
2:complement(798815..800326)
Genome map
AA seq 503 aa AA seqDB search
MQFNDILAALDVDLARWQGSALTARSPVDGATLATLAADSPADTERKIDAAHQAFLKWRT
VPAPVRGELVRVFGNVLREHKAALGRLVTLEAGKIASEGLGEVQEMIDICDFAVGLSRQL
YGLTIASERPGHRMMETWHPLGVCGVISAFNFPVAVWSWNAALAFVCGDPVVWKPSEKTP
LTAIACHALFAKAVREFDKTHPGVVPNGLHQLVLGGRDVGEALCASPKVPLVSATGSVRM
GVEVAQVLSRRLARSILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIV
HRSVADRLLPRLEKAFASVKVGDPLEAGTLVGPLIDRASFDAMQKALGDAREQGGEVKGG
ERVELGHADAYYVRPALVRMPRQTAVVTRETFAPILYVLVYDDFDDALAIHNGVPQGLSS
AIFTNDMREAEQFMSAAGSDCGIVNVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKSYM
RRATNTINYSRELPLAQGVKFDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcaacgacattctcgccgcgctcgacgtcgatctggcccgctggcaaggcagt
gcgctgaccgcccggtcgcccgtggacggcgcgacgctcgcgacgctcgccgccgacagc
ccggccgacaccgaacgcaagatcgacgccgcgcatcaggcgttcctcaagtggcgcacg
gtgcccgcgcccgtgcgcggcgagctcgtgcgcgtgttcggcaacgtgctgcgcgagcac
aaggcggcgctcggccggctcgtcacgctcgaggcgggcaagatcgcatccgaaggcctg
ggcgaagtgcaggagatgatcgacatttgcgatttcgcggtcggcctgtcgcggcagctc
tatggcctgacgatcgcgtccgagcgtcccggccaccggatgatggagacctggcatccg
ctcggcgtgtgcggcgtgatctccgcgttcaactttccggtcgcggtgtggtcgtggaac
gcggcgctcgcgttcgtgtgcggcgatccggtcgtctggaagccgtccgagaagactccg
ctcaccgcgatcgcatgccacgcgctgttcgcgaaggcggtgcgcgagttcgacaagacc
catccgggcgtcgtgcccaacgggctgcatcaactcgtgctcggcggccgcgacgtcggc
gaggcgctttgcgcttcgccgaaggtgccgctcgtgtccgcgacgggcagcgtgcggatg
ggcgtcgaggtcgcgcaggtgctgagccggcggctcgcgcgcagcattctcgagctcggc
ggcaacaacgggatgatcgtcgcgccgagcgcggatctcgatctcgtcgtgcgcgccgtg
acgttcgccgcggtcggcaccgcgggccagcgctgcacgacgctgcgccggctgatcgtg
catcgcagcgtcgccgatcgactgctgccgcgcctcgagaaggcgttcgcatcggtgaag
gtcggcgatccgcttgaagcgggcacgctcgtcggcccgctgatcgatcgcgcgtcgttc
gacgcgatgcaaaaggcgctcggcgatgcgcgcgagcagggcggcgaggtgaagggcggc
gagcgcgtcgagctcggccatgcggatgcgtactacgtgcgtccggcgctcgtgcggatg
ccgaggcagacggccgtcgtcacgcgcgagacgttcgcgccgattctgtacgtgctcgtc
tacgacgacttcgacgacgcgctcgcgatccacaacggcgtgccgcaagggctgtcgtcg
gcgatcttcacgaacgacatgcgcgaggccgagcaattcatgtcggcggcgggcagcgat
tgcgggatcgtcaacgtgaacatcggcacgagcggcgcggagatcggcggcgcgttcggc
ggcgagaaggaaacgggcggcggccgcgagtccggttccgacgcgtggaagagctacatg
cgccgcgcgacgaacacgatcaactacagccgcgaattgccgctcgcgcagggtgtgaag
ttcgacgtgtag

DBGET integrated database retrieval system