KEGG   Burkholderia thailandensis MSMB59: BTHA_5325Help
Entry
BTHA_5325         CDS       T03416                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
btv  Burkholderia thailandensis MSMB59
Pathway
btv00260  Glycine, serine and threonine metabolism
btv01100  Metabolic pathways
btv01110  Biosynthesis of secondary metabolites
btv01120  Microbial metabolism in diverse environments
btv01130  Biosynthesis of antibiotics
btv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTHA_5325
Enzymes [BR:btv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BTHA_5325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIS98892
Position
2:2129588..2130601
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSAPMLAAMTAAEVGDDVWGDDPTVARLQAVVAERAGKEAALFFPSGTQ
SNLAALMSHCERGDEYIVGQAAHTYKYEGGGAAVLGSIQPQPIENAADGTLPLEKIAAAI
KPIDDHFARSRLFALENTIGGKVLPADYVDEAVALARSRGLATHLDGARVCNAAVASGRT
LAQMCAPFDSISICFSKGLGAPVGSVLVGSRALIDRAHRWRKVLGGGMRQAGVLAAACLY
ALEHNVERLADDHANAERLAQGLARIEPVKVLSQATNMVFAQIPEADCAPLEAWLEERGI
LTQMLYASRFVTHCDVSRDDIDTAVAAISAYFARSRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacgcgcccgagcgcgccgatgctggccgcgatg
acggccgcggaagtgggcgacgacgtatggggcgacgatcccaccgtcgcgcgcctgcag
gccgtggtcgccgagcgcgcgggcaaggaggcggcgctgttctttccgagcggcacgcag
agcaacctcgcggcgctgatgtcgcattgcgagcgcggcgacgaatacatcgtcggccag
gccgcgcacacgtacaagtacgagggcggcggcgcggcggtgctcggcagcatccagccg
caaccgatcgagaacgccgccgacggcacgctgccgctcgagaagatcgcggccgcgatc
aagccgatcgacgatcacttcgcccgctcgcgcctgttcgcgctcgagaacacgatcggc
ggcaaggtgctgccggcggattacgtcgacgaggcggtcgcgctcgcgcgcagccgcggg
ctcgcgacgcatctcgacggcgcgcgcgtgtgtaacgcggccgtcgcatcgggccgcacg
ctcgcgcagatgtgcgcgccgttcgattcgatctcgatctgcttttcgaaggggctcggc
gcgccggtcggctcggtgctcgtcggcagccgcgcgctcatcgaccgcgcgcatcgctgg
cgcaaggtgctgggcggcggcatgcgccaggcgggggtgctcgcggccgcgtgcctgtat
gcgctcgagcacaacgtcgagcgcctcgccgacgatcacgcgaacgccgagcgccttgcg
caagggctcgcgcgaatcgagccggtgaaagtgttgtcgcaggcgacgaacatggtgttc
gcgcagattcccgaagccgattgcgcgccgctcgaagcgtggctcgaggagcgcggcatt
ctcacgcagatgctgtatgcgtcgcgcttcgtcacgcactgcgacgtgtcgcgcgacgac
atcgacacggccgtcgccgcgatcagcgcgtatttcgcgcgttcgcgcgcttga

DBGET integrated database retrieval system